Community

Community

Community - Top - Linkliste
Investoren - xXx - xXx
Linkindex

pr-navi.de|||aaa||| | zfür die Jugendarbeit slice call mod rocksolid window und init DOMContentLoaded init find video data-rsts-type video each Disable for videos this player type direction navType none scaleMode fit imagePosition center centerContent random loop true videoAutoplay autoplayProgress pauseAutoplayOnHover keyboard true captions controls true combineNavItems true duration autoplay autoplayRestart gapSize Fix missing lightbox links colorbox lightboxConfig loop rel this attr data-lightbox update links colorbox lightboxConfig update find data-lightbox update find data-lightbox Die Sommerkampagne Politikerinnen und Politiker besuchen Freizeiten Bereits zum sechsten alt und Inklusion Zukunft mit UNS! Phase Vielfalt Partizipation Finanzen Juleica Beratung und Bonus Publikationen und Infomaterial Qualifizierung und Weiterbildung Statistik der Angebote derKinder- und Jugendarbeit AKTUELLES Termine Veranstaltungen News Pressemitteilungen Landesjugendring Baden-Württemberg Siemensstr Stuttgart entdecke was geht mmenu nav mobile ready mmenu isMenu true offCanvas add true placeholder Suchen noResults Keine Ergebnisse gefunden showLinksOnly true selected active invisible setTimeout try new catch open GET onreadystatechange this readyState und this status und typeof und this responseText send systemcroncron txt parseInt n0 th Refugee Council Sommerkampagne MehrWert Themen umsetzen Bildung Ehrenamtliches Engagement Kommunales dreimaldrei - Stärkung der Jugendringe Medien Nachhaltige Entwicklung Vielfalt und Inklusion Zukunft mit UNS! Phase Wahl Phase Qualifizierung Beteiligungsprozessen Strukturaufbau neuer Jugendorganisationen Tickets ins Übermorgen Vielfalt Partizipation Finanzen Juleica Beratung und Bonus Qualifizierung und Weiterbildung Statistik der Angebote der Kinder- und Jugendarbeit Publikationen und Infomaterial Bestellkorb Bestellen Kampagne Die Sommerkampagne Jetzt entdecken! Refugees welcome! Jugendarbeit für und mit jungen Geflüchteten Die Wissenssammlung Net Willkommen beim Landesjugendring Baden-Württemberg - LJRBW window write window MooTools write entdecke was geht Navigation überspringen Presse Sitemap Kontakt Impressum Navigation überspringen Presse Sitemap Kontakt Impressum Navigation überspringen Start Aktuelles Landesjugendring Interessen vertreten Themen umsetzen Kampagne MENU Navigation überspringen Start Aktuelles Termine und Veranstaltungen News Pressemitteilungen Landesjugendring Über uns Aufgaben Außenvertretungen Mitglieder Grundlagenpapiere und Beschlüsse Positionspapiere und Stellungnahmen Interessen vertreten Politische Interessenvertretung Kindergipfel und Jugendlandtag U18-Jugendwahl You berg Damit den sechs Wochen keine Langeweile aufkommt gibt zahlreiche Freizeitangebote der Kinder- und Jugendverbände bei Hausfreizeiten Zeltlagern Stadtranderholungen Jugendreisen ins Ausland und Waldheimen gibt viel erleben EUR und viel tun Weiterlesen EUR Sommer Sonne Spiel und Spaß Aufbaumodul und Train the Trainer-Qualifizierung Einstieg noch möglich Basisqualifizierung Plus Arbeit mit jungen Geflüchteten Die Akademie der Jugendarbeit erweitert ihre Basisqualifizierung der Arbeit mit geflüchteten jungen Menschen weitere Schulungsangebote Zum Einen gibt weitere Fortbildungstage für pädagogische Mitarbeitende Bereich der Kinder- und Jugendarbeit sowi e Jugendsozialarbeit die sich speziell für die Arbeit mit geflüchteten jungen Menschen vertiefend fortbilden wollen Zum anderen ist mit zusätzlichen Fortbildungsbausteinen möglich sich als Trainer innen für Engagierte weiter qualifizieren Weiterlesen EUR LANDESJUGENDRING Über uns Aufgaben Außenvertretungen Mitglieder Grundlagenpapiere und Beschlu sse INTERESSEN VERTRETEN politischeInteressenvertretung Jugendlandtag und Kindergipfel U18-Jugendwahl Youth Refugee Council Sommerkampagne THEMEN UMSETZEN Bildung Ehrenamtliches Engagement Kommunales dreimaldrei Medien Nachhaltige Entwicklung Strukturaufbau neuerJugendorganisationen Tickets ins Übermorgen Vielf Mal laden die Organisationen Landesjugendring Abgeordnete des Landtags Baden-Württemberg den Sommerferien einem Besuch einer Freizeit oder eines Zeltlagers der verbandlichen Jugendarbeit ein Mehr zur Sommerkampagne Themen umsetzen Der Landesjugendring bearbeitet seinen Fachbereichen verschiedenste Themen von wie Alltagsbildung bis wie Zukunftsfähigkeit den Themen Der Kindergipfel Kinder reden EUR Politik hört Der dritte baden-württembergische Kindergipfel findet statt mehr Infos zum Kindergipfel Engagiert und qualifziert EUR Informationen und rund ehrenamtliches Engagement von Juleica bis hin zum Bundeskinderschutzgesetz den Veranstaltungen Sep Vorstand ftsführung Der die Stelleninhaber ist insbesondere für das interne Management der Geschäftsstelle zuständig und arbeitet der Geschäftsführung Eine wesentliche Aufgabe besteht der Vorbereitung und Betreuung sowie Protokollierung und Nachbereitung von Gremiensitzungen des Landesjugendrings insbesondere der zweimal Jahr tagenden Vollversammlung Weiterlesen EUR Wir suchen eine Assistenz der Geschäftsführung August Sozialminister und weitere Abgeordnete bei Sommerkampagne Presseeinladung Manne Lucha Minister für Soziales und Integration besucht Zeltlager Schwende Deggenhausertal Stuttgart Auch den Sommerferien laden die Organisationen Landesjugendring die Mi tglieder des Landtags Baden-Württemberg einem Besuch einer Freizeit oder eines Zeltlagers ein Dort können sie sich selbst davon überzeugen was Haupt- und Ehrenamtliche den Jugendverbänden alles möglich machen Und weil alle Spaß dabei haben sollen stellen viele Freizeiten den Abgeordneten Aufgaben die sie sich gemeinsam mit den jungen Teilnehmenden ausdenken Weiterlesen EUR Sozialminister und weitere Abgeordnete bei Sommerkampagne Juli Sommer Sonne Spiel und Spaß Unterschiedlichste Freizeitangebote der Jugendverbände lassen keine Langeweile aufkommen Sommerkampagne des Landesjugendrings Stuttgart morgigen Donnerstag starten die Sommerferien Baden-Württem HDJA Stuttgart Sep VIP Abschluss-Beratungsworkshop Politische Beteiligung Sep VIP Abschluss-Beratungsworkshop Förderung von Freiwilligem Engagement Stuttgart Okt Ringtagung Burg Liebenzell Okt Geschäftsführender Vorstand HDJA Stuttgart Kommende Termine September ready mod calendar click head mod calendar load this attr href mod calendar Montag Dienstag Mittwoch Donnerstag Freitag Samstag Sonntag Immer auf dem Laufenden!Zum LJR-Newsletter Neues und Aktuelles August Wir suchen eine Assistenz der Geschäftsführung Werde Teil unseres Teams! Der Landesjugendring Baden-Württemberg sucht zum nächstmöglichen Termin unbefristet Teilzeit eine Assistent der Geschä | |

ljrbw.de | Haus Heim Garten Nach Raum Ort Baumärkte Baumfällungen Einkaufsdienste Einrichtungshäuser Energieausweise Fußböden Gärtner Grundstücksverwaltung Haushaltsstrom Schlüsseldienste Sonnenschutz Vermessungen Medien Nachrichten Informationen Thema | | 1. ljrbw.de PR-Navi.de
2. ljrbw.de PR-Navi.de


Sex xXx fick Erotik sexy hardcore
sex | | |
5 Slider right Aktuelles Landesjugendring NRW sucht Honorarkraft Bewerbungsschluss 22 August 2016 mehr Kampagne jungesnrw zur Landtagswahl 2017 Wir fordern ein jungesnrw! mehr Wir hier - Bildung gemeinsam gestalten Ergebnisse und Zusammenfassung des Projekts Wir hier zum Download mehr Zum Newsarchiv und rsaquo PROJEKTE umdenken-jungdenken NDC Juleica Projekt Ö2 Wir hier Bündnis für F reiräume buntblick Twittern !function !d id src platform twitter comwidgets parentNode insertBefore twitter-wjs window gcfg lang de function po createElement po type po async true po src apis google comjsplusone getElementsByTagName 0 parentNode insertBefore po Termine 03 09 2016 - 04 09 2016 Projekt Waldwelten 07 09 2016 Köln No Blame Approach Workshop 09 09 2016 - 11 09 2016 Berlin fast 900 Freibadbesucherinnen mit dabei Mehr Infos zum Event Vollversammlung 2015 Auf der letzten Vollversammlung in Bochum beschloßen die Mitgliedsverbände im Landesjugendring NRW die inhaltlichen Schwerpunkte der kommenden zwei Jahre und wählten den Vorstand Weitere Informationen Erfolgreicher Jugendkongress im Landtag 200 Jugendliche aus Nordrhein-Westfalen haben im Landtag über Po 2016 12 Woche des bürgerschaftlichen Engagements 17 09 2016 - 18 09 2016 Bonn und Düsseldorf Erste Junge Islam-Konferenz in NRW 19 09 2016 VHS-Forum am Neumarkt Köln Junges Ehrenamt - fördern gewinnen beteiligen? 20 09 2016 Essen gender rockt - Jugendkulturelle Szenen und Inszenierungen 21 09 2016 - 22 09 2016 Mainz VISION INKLUSION Alle Termine RSS-FEEDNewsletterKontaktImpressum litik diskutiert Sie stellten Forderungen zu den Themen Bildung Freizeit Politik und Teilhabe sowie Umwelt und Wirtschaft auf Weitere Informationen buntblick 2016 gestartet Unser Jugendwettbewerb buntblick geht in die zweite Runde Ab jetzt dürfen wieder Foto- Film- und Audiobeiträge auf unsere Website http buntblick ljr-nrw de hochgeladen werden Teilnahmeschluss ist der 15 September 2 Landesjugendring NRW function src connect facebook netde DEall xfbml und appId parentNode insertBefore gaq push setAccount UA-45638525-1 gaq push function type async true src location ? ssl http www google-analytics comga getElementsByTagName 0 parentNode insertBefore NewsletterSitemapKontaktImpressum AktuellesNewsTermineJobsWettbewerbeÜber unsLandesjugendring NRWMitgliedsverbändeDer VorstandDie GeschäftsstelleGremien und SatzungBeschlüsseStellungnahmenArbeitsgruppenBündnisseKooperationenAußenvertretungThemenBildungEhrenamtEinmischende JugendpolitikInklusionInterkulturelle ÖffnungKommunale JugendpolitikKonsum und NachhaltigkeitPartizipationJugendarbeit NRWJugendverbandsarbeitStadt- und KreisjugendringeTräger und FachstellenKinder- und JugendförderplanJugendbildung Jugendkonferenz zur Jugendstrategie 09 09 2016 - 11 09 2016 Naturfreundehaus Hannover Wege zu Powersharing und Empowerment in Jugendverbänden und Bildungsarbeit 10 09 2016 Berlin JUGEND MEDIEN DIGITAL 10 09 2016 Mülheim an der Ruhr Junge Lesben Schwule und Bisexuelle in den Blick nehmen 12 09 2016 Haus Neuland Bielefeld Inklusive Medienarbeit mit jungen Geflüchteten 16 09 2016 - 25 09 sstättenArbeitsfelderJuleicaWir hierNDCÖ2 - Interkulturelle Öffnungumdenken - jungdenken!Bündnis für FreiräumebuntblickPublikationenBroschürenMaterialienGeschäftsberichteFilmePressePressemeldungenPressekontakt frei-schwimmen für junge Menschen Das Bündnis für Freiräume fordert Freiräume nicht nur sondern macht sie auch erlebbar Beim Event frei-schwimmen im Waldbad Köln-Dünnwald waren 016 Hier geht es zur Ausschreibung Fachkongress Perspektive Jugend Über 200 Teilnehmende aus Politik Wissenschaft Jugendarbeit und weiteren Bereichen diskutierten beim Fachkongress was sich seit 2012 getan hat und in welche Richtung einmischende Jugendpolitik gemeinsam weiterentwickelt werden soll Weitere Informationen zum Fachkongress Slider left Beitrag 2 Beitrag 3 Beitrag 4 Beitrag | ljr-nrw.de | 1. PR-Navi.de ljr-nrw.de
2. ljr-nrw.de PR-Navi.de


Sex xXx fick Erotik sexy hardcore
Jugendarbeit in Rheinland Pfalz
ica Ferienbörse Rheinland-Pfalz Jugendsammelwoche Landesjugendring Rheinland-Pfalz Kontakt Impressum Sitemap Entweder unterstützt Ihr Browser oder Endgerät kein oder dieses wurde deaktiviert Wir haben darauf geachtet dass dennoch alle Inhalte dieser We eteiligung von Kindern und Jugendlichen allen gesellschaftlichen politischen und sozialen Bereichen die Anerkennung ehrenamtlichen Engagements junger Menschen die Anerkennung der Jugendverbände als außerschulische Bildungsträger ein lebendiges demokrat treicht ihr mit der Maus über die Fotos öffnen sich weitere Kategorien Auf unserer Homepage sind Informationen unserer Arbeit unseren Schwerpunkten und Positionen zusammengestellt Wir informieren über die Fördermöglichkeiten für unsere Mitgliedsverbänd iner Mitgliedsverbände sowie aller Kinder und Jugendlichen Rheinland-Pfalz gegenüber Politik und Gesellschaft Der Landesjugendring setzt sich ein für bestmögliche finanzielle und rechtliche Bedingungen der Kinder- und Jugendarbeit Rheinland-Pfalz die B Home Landesjugendring RLP Home Verbinden Bewegen Fördern Keyword Suchen Inhaltsseiten Newsbeiträge Newsletter Menschen verbinden Mitgliedsverbände Partner LJR e Politik bewegen BildungJugendarbeit Demokratie Ehrenamt Jugend fördern Bildungsmaßnahmen Me bseite problemlos erreichbar sind Sollten Sie Probleme feststellen wenden Sie sich bitte uns Vielen Dank Piwik from piwik paq stats guite paq push setSiteId paq push piwik php paq push type defer true async true src piwik js parentNode insertBefore isches Zusammenleben allen Bereichen der Gesellschaft ohne nationalistische rassistische sexistische und diskriminierende Strukturen die Gleichberechtigung von Mädchen und Jungen sowie Frauen und Männern die Schaffung gleicher Lebens und Bildungschance dienpädagogik Spendenvergabe JSW Home Willkommen beim Landesjugendring Rheinland-Pfalz Wir freuen uns über Euren Besuch auf unserer Internetseite! Über die drei roten Felder EURverbindenEUR EURbewegenEUR und EURfördernEUR findet ihr unsere Untermenüs S e die EURJuleicaEUR die Jugendsammelwoche EUR und vieles mehr Solltet ihr trotzdem einmal nicht finden was ihr sucht freuen wir uns über Euren Anruf oder eine E-Mail Wer wir sind Der Landesjugendring vertritt als gemeinnütziger Verein die Interessen se n für alle Kinder und Jugendlichen einen bewussten und nachhaltigen Umgang mit Natur und Umwelt Top-Hits Positionen und Beschlüsse Antragsformular Bildungsmassnahmen Bündnis Bildung braucht Freiräume Zurück LJR-News Gute Jugendpolitik Landtagswahl Jule
Geld Börse Finanzen Ihr Internet Kommunikation TOP Listen Medien Nachrichten Informationen Thema Welt der Frau Männer WeltderFrau WeltderMänner

| ljr-rlp.de
1. PR-Navi.de ljr-rlp.de
2. PR-Navi.de ljr-rlp.de


Sex xXx fick Erotik sexy hardcore
| ljrsh.de | endringe Sonstige Adressen Termine Materialien Jugendsammlung Junge Geflüchtete Presse Links Eurodesk Kontakt Impressum Suchen LandesjugendringSchleswig-Holstein e Holtenauer Straße Kiel Tel Fax ljrsh info ljrsh Haus Rothfos Jugendbildungs- und Begegnungsstätte Wiesengrund Mözenbei Bad Segeberg Tel Fax haus-rothfos info haus-rothfos Länderabend und Spendenübergabe beim Ostsee-Jugendmediencamp Dienstag August KielMözen und Labas und Laukiamas und also und Hallo und Herzlich Willkommen und hießes aus Rothfos Mehr Fortbildung Kinderschutz Montag Mai findet von Uhr die Fortbildung Kinderschutz -Umsetzungsmöglichkeiten des Bundeskinderschutzgesetzes und Handlungsschritte für haupt- und ehrenamtliche Jugendleiter innen bei Kindeswohlgefährdung- Mözen Haus Rothfos statt Mehr Jugendsammlung beginnt Mai Donnerstag Mai Landtagspräsident Schlie lud erfolreiche Sammelgruppen des Vorjahres zum Auftakt ein Mehr Jugend-Freizeitstättenverzeichnis ist da! Freitag April Landesjugendring Schleswig-Holste jugendringe Stadt- und Ortsjugendringe Weitere Adressen Kreis- und Stadtjugendpfleger Bundesjugendring Landesjugendringe Sonstige Adressen Termine Materialien Jugendsammlung Junge Geflüchtete Presse Links Eurodesk Kontakt Impressum mainmenu jsmainmenu mainmenu display block Startseite Wir über uns Vorstellung Vorstand Geschäftsstelle Mitglieder Mitgliedsverbände Anschlussverbände Kreisjugendringe Stadt- und Ortsjugendringe Weitere Adressen Kreis- und Stadtjugendpfleger Bundesjugendring Landesjug Sonntag den August für Jugendliche aus Dänemark Litauen Polen Russland Afghanistan Mecklenburg-Vorpommern und Schleswig-Holstein der Jugendbildungsstätte Haus Rothfos Mözen bei Bad Segeberg Rahmen eines Länderabends beim Ostsee-Jugendmediencamp präsentierten die Teilnehmer innen aus Litauen und Russland ihre Heimatländer Die Gäste und Teilnehmer innen zeigten sich von der vielfältigen Kultur der beiden Länder beeindruckt und konnten nationale Speisen probieren Zudem erhielten die Teilnehmer inne und die Zivilgesellschaft sich mit den demokratie- und menschenfeindlichen Positionen der AfD sehr kritisch auseinanderzusetzen Nicht wenige der Protagonist innen der AfD stammen aus rechtsextremistischen Zusammenhängen und sind Wahlkampf immer wieder durch rassistische fremdenfeindliche und nationalistische Sprüche aufgefallen Solche Haltungen werden von den Jugendverbänden und Jugendringen Deutschland nicht akzeptiert Mehr Einladung einem Interkulturellen Trainingstag Rendsburg Mittwoch März L estartet Dienstag Juni Wer macht mit beim Spendensammeln? Mehr Einladung Fachtagung Förderung der Jugendarbeit auf Landesebene Montag Juni Haus Rothfos Mehr Landesjugendring legt jugendpolitische Forderungen zur Landtagswahl vor Montag Mai Vollversammlung spricht sich für mehr Vielfalt und gleiche Chancen für alle jungen Menschen aus Mehr Versicherungsfragen der Jugendarbeit Dienstag Mai Seminar für ehren und hauptamtliche Mitarbeiter innen der Jugendarbeit Mehr Einladung Fachtagung Montag Mai H in und die schleswig-holsteinischen Sparkassen geben Freizeitstättenverzeichnis bis heraus Mehr Bundes-Jugendarbeitsstatistik Informationstagung für Jugendarbeiter innen Schleswig-Holstein Sonntag April Mittwoch April Uhr und Uhr Haus Rothfos Wiesengrund Mözen bei Bad Segeberg Mehr Landesjugendringe schockiert über hohen Zuspruch für die AfD Dienstag März Die Landesjugendringe Deutschland werten den hohen Zuspruch für die rechtspopulistische AfD als dringende Warnung die demokratischen Parteien n einen Sprachkurs die teils komplizierten Sprachen der beiden Länder Mehr Einladung Jugendtourismustag Donnerstag Juli Liebe Freundinnen und Freunde der Jugendtourismustag des Landesjugendrings Schleswig-Holstein wirft unter dem Motto und Neue Chancen und einen Blick auf die Strukturen und Entwicklungen des Jugendtourismus Schleswig-Holstein Mehr Jahre MuseumsCard Mittwoch Juni Freier Eintritt für Kinder und Jugendliche vom Juli bis November Mehr Kein Kind ohne Ferienerholung und Crowdfunding g iebe Freund innen hiermit lade ich Euch herzlich einem Interkulturellen Trainingstag der Katholischen Kirchengemeinde Martin Rendsburg ein Mehr Versicherungsseminar Donnerstag Februar Liebe Freundinnen und Freunde sehr geehrte Damen und Herren der Termin für das Versicherungsseminar musste vom auf den verlegt werden Mehr Zum News-Archiv Seite von Insgesamt Piwik from piwik paq stats guite paq push setSiteId paq push piwik php paq push type defer true async true src piwik js parentNode insertBefo Landesjugendring Schleswig-Holstein e Jugendarbeit Jugend Termine Seminare Materialien Infos Landesjugendring Schleswig-Holstein e Landesjugendring Mädchen- und Frauenarbeit den Jugendverbänden Jugendbildungsstätte Haus Rothfos Freizeitstättenverzeichnis Ferienbörse Ostsee-Jugendbüro Ostseesekretariat für Jugendangelegenheiten Ostsee-Jugendstiftung Stiftung Jugendarbeit Sie sind hier Startseite Wir über uns Vorstellung Vorstand Geschäftsstelle Mitglieder Mitgliedsverbände Anschlussverbände Kreis | Sparen Versicherungen Heim Hausrat Sonstiges Tier
Der Landesjugendring Schleswig Holstein wurde 1949 gegründet und hat heute 24 Mitgliedsverbände und zahlreiche Anschlussverbände mit insgesamt etwa 500 000 Mitgliedern Die Mitglieder des Landesjugendrings die Jugendverbände verfügen über 20 000 ehrenamtliche Mitarbeiterinnen und Mitarbeiter und sind die Hauptanbieter von Ferien Freizeit und Jugendbildungsmaßnahmen im Lande
| 1. ljrsh.de PR-Navi.de
2. ljrsh.de PR-Navi.de

Sex xXx fick Erotik sexy hardcore
| sex

LJV-NRW Am 18 und 19 Juni findet der 30 Landeswettbewerb im Jagdhornblasen am Oberen Schloss in Siegen statt Die Kreisjägerschaft Siegerland-Wittgenstein und der Landesjagdverband NRW erwarten an diesem Wochenende rund 2 000 Jagdhornbläser aus etwa 120 Bläsergruppen Nordrhein-Westfalens und Gastgruppen aus anderen Bundesländern weiter Aktuelles Verfassungsbeschwerden in Karlsruhe gegen nordrhein-westfälisches Jagdgesetz Volksinitiative bereits erfolgreich EUR Auch der Landtag wird sich erneut mit dem Gesetz befassen müssen 18 Mai 2016 LJV-NRW Gegen das vor einem Jahr verabschiedete und heftig umstrittene NRW-Landesjagdgesetz sind neben zahlreichen fachgerichtlichen Klagen jetzt auch zwei Verfassungsbeschwerden beim Bundesverfassungsgericht in Karlsruhe eingereicht worden Prozessbevollmächtigte sind der Rechtsexperte Prof Dr Johannes Dietlein vom Lehrstuhl für Öffentliches Recht und Verwaltungslehre der Heinrich-Heine-Universität Düsseldorf sowie der Rechtsanwalt Hans-Jürgen Thies aus Hamm Der Landesjagdverband Nordrhein-Westfalen unterstützt die Verfassungsbeschwerden weiter Aktuelles Bundeslandwirtschaftsminister hält Wort 17 Mai 2016 LJV-NRW Für viele ungeklärte Fragen sorgt noch immer das Urteil des Bundesverwaltungsgericht vom 07 03 2016 hinsichtlich halbautomatischer Jagdgewehre mit Wechselmagazinen Das Bundeslandwirtschaftsministerium BMEL beabsichtigt im Rahmen einer Änderung des Bundesjagdgesetzes BJagdG eine gesetzliche Regelung der bisherigen Verwaltungspraxis beim Thema Halbautomaten unverzüglich herbeizuführen Dies begrüßen der DJV und das Forum Waffenrecht in Ihrer Pressemeldung vom 13 05 2016 ausdrücklich Für NRW hielt zusätzlich das Ministerium für Klimaschutz Umwelt Landwirtschaft Natur- und Verbraucherschutz des Landes Nordrhein-Westfalen mit Erlass vom 29 04 2016 fest dass von dem Urteil folgende Waffen nicht betroffen sind Halbautomatische Pistolen Halbautomatische Selbstladebüchsen mit fest eingebautem Magazin mit maximalem Fassungsvermögen von zwei Patronen Halbautomatische Selbstladeflinten mit feststehendem Röhrenmagazin mit maximalen Fassungsvermögen von zwei Patronen weiter WILD Wildschweine profitieren von milden Temperaturen 25 04 2016 Der DJV veröffentlicht WILD-Jahresbericht 2014 Das Wildtierinformationssystem der Länder Deutschlands erfasst neben Streckenstatistiken auch Informationen über Populationsentwicklungen ausgewählter Arten Wildkrankheiten und Wildunfälle weiter Aktuelles Verbände-Allianz nimmt Bundesminister Schmidt beim Wort 15 April 2016 djv Berlin Bundeslandwirtschaftsministerium will Rechtsklarheit für halbautomatische Waffen schaffen Laut Bundesminister Christian Schmidt bezieht sich das Urteil aus Leipzig nicht auf Pistolen und Revolver Bundeslandwirtschaftsministerium will Rechtsklarheit für halbautomatische Waffen schaffen Quelle KapuhsDJV Bund der Militär- und Polizeischützen BdMP Bund Deutscher Sportschützen BDS Deutscher Jagdverband DJV Deutsche Schießsport Union DSU Deutscher Schützenbund DSB Forum Waffenrecht FWR Verband der Hersteller von Jagd- Sportwaffen und Munition JSM und Verband Deutscher Büchsenmacher und Waffenfachhändler VDB begrüßen eine erste Klarstellung des Bundeslandwirtschaftsministeriums als Reaktion auf das gestrige Protestschreiben weiter Aktuelles EURGesetzgeber droht Glaubwürdigkeit zu verlierenEUR Hinweise zu den Urteilen des Bundesverwaltungsgerichts in Sachen halbautomatischer Waffen 13 04 2016 LJV-NRW Ralph Müller-Schallenberg Präsident des Landesjagdverbandes Nordrhein-Westfalen hat sich wegen der Urteile des Bundesverwaltungsgerichts zum Besitz halbautomatischer Waffen an den nordrhein-westfälischen Innenminister gewandt um Unklarheiten und Beeinträchtigungen von Jägern zu vermeiden Unterdessen hat sich LJV-Justitiar Hans-Jürgen Thies in Interviews z B gegenüber der Internetplattform Outfox öffentlich ausführlich zu dem Sachverhalt geäußert weiter Aktuelles Demoaufruf für Mittwoch den 13 April 2016! Ma einer Problemlösung interessiert EUR weiter Aktuelles Fundbüros müssen streunende Katzen annehmen 15 Oktober 2015 Münster LJV-NRW Fundbüros der Städte und Gemeinden in Nordrhein-Westfalen müssen von Jägern aufgenommene streunende Katzen annehmen weiter Steffi Nerius Speerwurfweltmeisterin 2009 eröffnet gemeinsam mit Klaus Hübenthal l Hauptgeschäftsführer des DEHOGA-NRW und Ralph Müller-Schallenberg r Präsident des Landesjagdverbandes NRW die NRW-Wildwochen 2015 Intro Wildwochen Wildbret - Von Natur aus fit! Steffi Nerius Weltmeisterin im Speerwurf 2009 ist selbst begeisterte Jägerin isst gerne Wildbret und eröffnete am 12 Oktober auf der weltgrößten Nahrungs- und Genussmesse der Anuga die diesjährigen NRW-Wildwochen Tourismus NRW mit dabei 12 Oktober 2015 Köln LJV-NRW Als bewährte Kooperationspartner mit dabei sind der DEHOGA NRW der Fleischerverband NRW sowie der Landesbetrieb Wald und Holz NRW Erstmals beteiligt sich in diesem Jahr auch der Verein Tourismus NRW an den NRW-Wildwochen weiter Demo in Wiesbaden 28 September 2015 Aktuelles 3 500 Jäger auf dem Kranzplatz in Wiesbaden LJV Hessen demonstriert gegen die geplante schwarz-grüne Jagdverordnung BerlinWiesbaden 28 September 2015 Mehr als 3 500 Jägerinnen und Jäger haben am Samstag in Wiesbaden gegen die geplante Jagdverordnung von Schwarz-Grün demonstriert Jäger kamen nicht nur aus Hessen sondern auch aus den angrenzenden Bundesländern Der DJV war live vor Ort und hat via Facebook und Twitter berichtet weiter Dr Michl Ebner Präsident des europäischen Jägerverbands Dr Böhning Vizepräsident Aktuelles FACE wählt neuen Vorstand Dr Michl Ebner Präsident des europäischen Jägerverbands Dr Böhning Vizepräsident Berlin 18 September 2015 Die Generalversammlung von FACE dem Zusammenschluss der europäischen Jagdverbände hat in Brüssel einen neuen Vorstand gewählt Dr Michl Ebner aus Südtirol wird künftig als Präsident die Geschicke von FACE leiten Der 62-jährige gelernte Journalist war lange Jahre Mitglied des Italienischen und danach des Europäischen Parlaments Ebner spricht fließend deutsch und italienisch weiter Aktuelles Verbände des ländlichen Raumes in NRW fordern und bdquo Kein Stillstand auf dem Land! und ldquo - Kritik am Entwurf des Landesnaturschutzgesetzes - Kritik am Entwurf des Landesnaturschutzgesetzes Der Entwurf für das Landesnaturschutzgesetz NRW findet in wesentlichen Teilen nicht die Zustimmung der siebzehn Partnerverbände im EURAktionsbündnis Ländlicher RaumEUR Die Kernkritik richtet sich gegen nicht hinnehmbare Eingriffe in Eigentumsrechte und Einschränkungen für Landwirte Waldbauern Gärtner Jäger und Fischer weiter Foto Frank Martini Aktuelles DJV und LJV rufen zur Demonstration in Hessen auf Protest gegen geplante Landesjagdverordnung in Wiesbaden am 26 September Berlin 03 September 2015 Der Deutsche Jagdverband DJV und der Landesjagdverband Hessen LJV Hessen rufen zur gemeinsamen Demonstration gegen die geplante Landesjagdverordnung JVO in Hessen auf Unter dem Motto Hände weg vom Jagdrecht! - Keine Aushöhlung durch die neue Jagdverordnung! werden am Samstag dem 26 September in Wiesbaden mehrere tausend Jäger erwartet Der orange-farbene Protestzug wird um 11 00 Uhr am Hauptbahnhof in Wiesbaden starten und am Kranzplatz vor der Hessischen Staatskanzlei enden Dort findet ab 12 00 Uhr eine Kundgebung mit Vertretern aus Politik und Verbänden statt weiter Aktuelles Komitee wieder aktiv Teil 2 weiter Aktuelles Komitee wieder aktiv weiter Aktuelles DJV und CIC begrüßen UN Resolution gegen Wilderei und Wildtierschmuggel Berlin 13 August 2015 Der Deutsche Jagdverband DJV und die deutsche Delegation des Internationalen Rates zur Erhaltung des Wildes und der Jagd CIC Deutschland begrüßen die Resolution zur Bekämpfung der Wilderei und des illegalen Handels mit Wildtieren die von der 69 Vollversammlung der Vereinigten Nationen kürzlich in New York verabschiedet wurde Die Bundesrepublik Deutschland und Gabun hatten die Resolutio eichnet Mit der Initiative Lernort Natur bieten die Jägerinnen und Jäger Deutschlands vielfältige Möglichkeiten die Natur mit allen Sinnen EURwiederEUR zu entdecken Was liegt also näher als das Jubiläumsjahr im Mutterland von Lernort Natur zu starten So ist diese Umweltbildungsinitiative der Jäger an der sich alleine in NRW über 1000 Jägerinnen und Jäger aktiv beteiligen eines der Leitthemen auf der Jagd und Hund 2016 vom 9 bis 14 Februar weiter Quelle DJV EURJagd ist angewandter Tierschutz EUR Aktuelles Leistungen der Jäger für den Tierschutz anerkannt dennoch Klage abgewiesen 17 Dezember 2015 Gelsenkirchen LJV NRW Der Landesjagdverband NRW LJV ist über das heutige Urteil des Verwaltungsgerichtes Gelsenkirchen mit dem seine Klage auf Anerkennung als Tierschutzverein abgewiesen wurde mehr als enttäuscht zumal das Gericht die Leistungen eines jeden einzelnen Jägers und auch des Landesjagdverbandes für den Tierschutz ausdrücklich hervorgehoben und gelobt hat weiter Aktuelles Waffenrechtsverschärfung verhindert Terror nicht Der Deutsche Jagdverband DJV fordert Jäger auf Kritik bei der EU-Kommission zu äußern Grund sind die Änderungsvorschläge der Feuerwaffenrichtlinie Geplante Waffenrechtsverschärfung kann Terror nicht verhindern sondern schafft unnötige Hürden Quelle djv Geben Sie hier Ihre Meinung ab bit ly1kTV7aO 01 Dezember 2015 djv Berlin Die Europäische Kommission bittet um Rückmeldung zu den Änderungsvorschlägen der Feuerwaffenrichtlinie Diese sollen eine Antwort auf die furchtbaren Terroranschläge in Paris sein Der Deutsche Jagdverband DJV bedauert die Tragödie in Frankreich und drückt den Angehörigen der Opfer sein tiefes Mitgefühl aus weiter Intro Wildwochen Wildbraten haben zu Weihnachten Hochsaison Woher kann man gesundes Wildfleisch aus der Region beziehen? Wildfleisch EUR oder Wildbret wie es auch genannt wird EUR ist eines der beliebtesten Festtagsessen der Deutschen während der Weihnachtsfeiertage Doch woher man den Braten von heimischem Reh Wildschwein oder Hirsch beziehen soll ist für viele ein Rätsel weiter Aktuelles EU-Waffenrecht soll nach Anschlägen verschärft werden 19 November 2015 DJV Berlin Nach den Anschlägen in Paris plant die EU eine Verschärfung des Waffenrechts So wichtig auch konkrete Maßnahmen zur Bekämpfung des Terrorismus sind die geplanten Schritte treffen die Falschen Eine Petition hat das Thema aufgegriffen weiter Quelle Tierfotoagentur de HarbigDJV Aktuelles Aujeszkysche Krankheit im Altmarkkreis Salzwedel nachgewiesen Jagdhunde von Drückjagdstrecken fernhalten Monitoring der Veterinärämter unterstützen Berlin 05 November 2015 Die Aujeszkysche Krankheit AK ist kürzlich im Altmarkkreis Salzwedel in Sachsen-Anhalt an der Grenze zu Niedersachsen nachgewiesen worden Dies nimmt der Deutsche Jagdverband DJV zum Anlass um Jägerinnen und Jäger auf das Risiko der Ansteckung von Jagdhunden und Hausschweinen aufmerksam zu machen weiter Aktuelles Zusammenarbeit weiter bestärkt Dass sich der Jagdgebrauchshundverband die Jagdkynologische Landesvereinigung und der Landesjagdverband auch weiterhin gemeinsam für die Interessen des Jagdgebrauchshundwesens in NRW einsetzen war einvernehmliches Ergebnis eines Gespräches zwischen ihren Vertretern Ende Oktober in Dortmund weiter Foto Heinz Dieter Fuhr Aktuelles Impfschutz - ein Muss und keine Lästigkeit! Dass dies offensichtlich des Öfteren anders gesehen wird legen Erfahrungen und Gespräche nahe die mit Sicherheit jeder schon einmal gehört oder geführt hat EURTollwut gibt es doch nicht mehrEUR oder auch EURImpfen belastet den Hund EUR sind nur zwei Beispiele hierfür weiter Aktuelles Umweltministerium arbeitet offensichtlich nicht am Katzenproblem Ralph Müller-Schallenberg EURDie öffentliche Diskussion und Rechtsprechung ist längst ohne Beteiligung des Umweltministeriums fortgeschritten Wer gar nicht auf die Sorgen Probleme und Anregungen von Kommunen Jägern Tier- und Naturschützern eingeht ist offensichtlich nicht an gdeburgDortmund 12 April 2016 Die Koalitionsverhandlungen in Sachsen-Anhalt sind kurzfristig auf kommenden Donnerstag terminiert worden Dem Vernehmen nach sollen Bündnis 90Die Grünen das Umweltressort bekommen und ähnlich wie in NRW sind erhebliche Restriktionen gegenüber dem gesamten ländlichen Raum zu erwarten Aus diesem Grund will der Landesjagdverband Sachsen-Anhalt gemeinsam mit seinen Partnerverbänden im ländlichen Raum am kommenden Mittwoch 13 April 2016 in Magdeburg demonstrieren Infos zur Demonstration WANN? 13 April 2016 11 00 Uhr TREFFPUNKT 10 15 am Magdeburger Dom Schlepperfahrer treffen sich auf dem Parkplatz an der Sternbrücke siehe Skizze unter http www ljv-sachsen-anhalt dedatamediapoolinfos zur demonstration pdf WER? Alle Menschen des ländlichen Raumes Jägerinnen Jäger Jagdgenossen Land- und Forstwirte Grundeigentümer Waldbesitzer und andere Naturfreunde WAS MUSS MIT? Orangefarbene Warnkleidung Jagdhörner Demonstrationsplakate KONTAKT? Wilko Florstedt 0170 2074226 Telefon 039205 41 75 70 E-Mail info ljv-sachsen-anhalt de Internet www ljv-sachsen-anhalt de Bitte leiten Sie diese Information an möglichst viele Adressaten weiter und unterstützen Sie wenn eben möglich durch Ihre Teilnahme unsere Jagdfreunde und alle Partner des ländlichen Raums in Sachsen-Anhalt Aktuelles Verunsicherung bei Behörden und Jägern wächst DJV veröffentlicht Hinweise für Besitzer halbautomatischer Waffen mit Wechselmagazin Berlin 7 April 2016 Das Bundesverwaltungsgericht hat sich in einer Einzelfallentscheidung Anfang März 2016 zum Besitz von Halbautomaten mit wechselbarem Magazin durch Jäger dahingehend geäußert dass diese nicht ohne besonderes Bedürfnis besessen werden dürfen Damit geht das Gericht nach Auffassung des DJV weit über seine Kompetenzen hinaus und stellt die derzeitige bislang unumstrittene Gesetzeslage in Frage weiter Aktuelles Bundesverwaltungsgericht hält die Verwendung halbautomatischer Waffen durch Jäger für unzulässig 1 April 2016 LJV-NRW Mit zwei Urteilen vom 07 03 2016 Az 6 C 59 14 und 6 C 60 14 hat das Bundesverwaltungsgericht entschieden dass halbautomatische Waffen mit wechselbarem Magazin bei der Jagdausübung generell nicht zulässig sind Das Gericht hat dies aus der Verbotsnorm des 19 Abs 1 Nr 2 c Bundesjagdgesetz abgeleitet Danach sei es untersagt auf Wild mit halbautomatischen Waffen zu schießen die mehr als zwei Patronen in das Magazin aufnehmen können Gerade aber diese Möglichkeit böten halbautomatische Waffen mit wechselbarem Magazin ln diesem Zusammenhang hielt es das Gericht für ausreichend dass derartige Waffen abstrakt geeignet sind mit mehr als zwei Patronen im Magazin aufmunitioniert werden zu können Fehle es deshalb an der generellen jagdrechtlichen Zulässigkeit halbautomatische Waffen mit wechselbarem Magazin bei der Jagd auf Wild zu verwenden dann bestünde für Jäger auch kein waffenrechtliches Bedürfnis solche Waffen überhaupt zu erwerben und zu besitzen Damit stellte das BVerwG den bisher legalen Erwerb und Besitz halbautomatischer Waffen mit Wechselmagazin durch Jäger grundsätzlich in Frage weiter Your browser does not support the video tag Startseite LJV Jagd für mehr Sicherheit! 17 März 2016 Köln Dortmund LJV NRW Jagd ist unverzichtbar für Tier- Natur- und Artenschutz ebenso zum Schutz der Land- und Forstwirtschaft vor Wildschäden Das weiß jeder Doch auch an Orten wo man sie gar nicht vermutet z B auf Flughäfen sind Jäger unentbehrlich und sorgen für mehr Sicherheit Begleiten Sie Ulf Muuß einen dieser Jäger auf dem Kölner Flughafen! weiter WILD Osterhasen-Bestand seit 14 Jahren stabil Frühjahr 2015 bundesweit 11 Mümmelmänner pro Quadratkilometer Berlin 14 März 2016 Durchschnittlich 11 Feldhasen haben Jäger und Wissenschaftler pro Quadratkilometer auf Deutschlands Feldern und Wiesen im Frühjahr 2015 gezählt Dies geht aus aktuellen Monitoring-Daten hervor die der Deutsche Jagdverband DJV heute veröffentlicht hat Ausgewertet haben Wissenschaftler die n initiiert weiter Aktuelles Anpassung der Richtlinien zur Feststellung der Brauchbarkeit von Jagdhunden in Nordrhein-Westfalen in Kraft Dortmund 12 August 2015 Nach 30 Absatz 1 LJG NRW sind bei der Such- und Bewegungsjagd bei der Jagd auf Wasserwild sowie bei jeder Nachsuche brauchbare Jagdhunde zu verwenden Gemäß Ziffer 6 der Verwaltungsvorschrift zum Landesjagdgesetz Nordrhein-Westfalen VV LJG NRW obliegt es den Kreisgruppen des Landesjagdverbandes gemeinsam mit den Mitgliedsvereinen des Jagdgebrauchshundverbandes JGHV die Brauchbarkeitsprüfungen durchzuführen weiter Wohl niemand kennt die Änderungen und Fallstricke des neuen Landesjagdgesetzes besser als LJV-Präsident Ralph Müller-Schallenberg Bild und LJV-Justiziar Hans-Jürgen Thies Aktuelles LJV schult Mitglieder zum neuen Landesjagdgesetz Wohl niemand kennt die Änderungen und Fallstricke des neuen Landesjagdgesetzes besser als LJV-Präsident Ralph Müller-Schallenberg Bild und LJV-Justiziar Hans-Jürgen Thies die im August Schulungstermine zum neuen Jagdrecht für LJV-Mitglieder anbieten Multiplikatoren wie KJS-Vorstände Hegeringleiter Jungjägerausbilder und Kreisjagdberater werden derzeit schon geschult Teilnahme nur für Mitglieder des Landesjagdverbandes NRW mit vorheriger Anmeldung bis zum 12 08 2015 für Termin in Köln und 19 08 2015 für Termin in Werl Anmeldecoupon Den Anmeldecoupon finden Sie auch im Rheinisch-Westfälischen Jäger in den Ausgaben 72015 und 82015 und auf RWJ-Online weiter Ralph Müller-Schallenberg Bildmitte schafft großes Medieninteresse für die Anliegen der Jagd rechts im Bild Hilmar Riemenschneider Landespressekonferenz links Christof J Marpmann Hauptgeschäftsführer des Landesjagdverbandes NRW Aktuelles Deutliche Kritik an NRW-Jagdpolitik Ralph Müller-Schallenberg redet Klartext auf der Landespressekonferenz Düsseldorf 16 Juni 2015 Ralph Müller-Schallenberg Präsident des Landesjagdverbandes Nordrhein-Westfalen LJV kritisierte heute in Düsseldorf vor der Landespressekonferenz mit scharfen Worten Inhalt und Intention des neuen Landesjagdgesetzes sowie den brachialen Politstil der NRW-Landesregierung im dazugehörigen Gesetzgebungsverfahren Das Gesetz bietet nicht mehr sondern deutlich weniger an Tier- Natur- und Artenschutz Es wurde in beispielloser Weise ohne jede fachlich parlamentarische Beratung durch den Landtag gepeitscht war von zahlreichen Skandalen und Skandälchen der Landesregierung begleitet und diskreditiert den gesamten ländlichen Raum anstatt diesen zu stärken weiter Aktuelles Landesjagdverband rügt journalistischen Fehltritt mit Ansage in der WDR-Sendung EURTiere suchen ein ZuhauseEUR vom 7 Juni 11 Juni 2015 Dortmund LJV Der Landesjagdverband NRW LJV bestätigt eine Interviewanfrage der WDR-Sendung EURTiere suchen ein ZuhauseEUR abgelehnt zu haben Die Gründe dafür wurden der Redaktion erläutert Das Abschreiben des LJV kann hier am Seitenende eingesehen werden weiter Intro - Natur- und Wildschutz Noch nicht aus dem Ei und schon gefressen Waschbär bedroht seltene Sumpfschildkröte Berlin 04 Juni 2015 Die Europäische Sumpfschildkröte ist Reptil des Jahres Die Ehrung ist zugleich ein Verweis auf eine besonders bedrohte Art Im Nordosten Brandenburgs existiert eines der letzten Vorkommen in Deutschland das staatliche Naturschützer seit 1993 gemeinsam mit Jägern betreuen Um die Population weiterhin zu erhalten und wieder großräumig zu etablieren fordert der Deutsche Jagdverband eine Bejagung von Fressfeinden insbesondere in den Brutgebieten EURLebensraum verbessernde Maßnahmen und eine intensive Fangjagd helfen stark bedrohten Arten wie der Sumpfschildkröte erklärt DJV-Artenschutzexpertin Astrid Sutor weiter Aktuelles Neufassung des neuen Landesjagdgesetzes jetzt online 1 Juni 2015 Dortmund LJV Die Neufassung des Landesjagdgesetzes kann jetzt online als konsolidierte Fassung auf den Internetseiten des NRW-Innenministeriums aufgerufen werden Hier der Link recht nrw delmiowabr text anzeigen?v id 1 0000107 Aktuelles Klare Worte von Ralph Müller-Schallenberg auf dem Landesjägertag in Schmallenberg 1 Juni 2015 Schmallenberg LJV Klare Ansage von Jägerpräsident Ralph Müller-Schallenberg am 30 Mai auf dem Landesjägertag in Schmallenberg zum neuen Landesjagdgesetz EURDer LJV setzt mit seinen Partnern den Kampf in Politik Gesellschaft und vor Gericht so lange fort bis sachlich-fachlich gute Ergebnisse erzielt sind Die nächsten Schritte sind weiter Aktuelles Zahl der Großtrappen steigt Fangjagd hilft bei Populationsentwicklung Berlin 28 Mai 2015 197 Großtrappen leben derzeit wieder in Deutschland Seit 1997 sind damit die Bestände um fast 400 Prozent gestiegen Der Deutsche Jagdverband DJV begrüßt die positive Populationsentwicklung EUR allerdings gibt es keinen Grund zur Entwarnung Der schwerste flugfähige Vogel der Welt findet in Deutschland nur noch wenige Lebensräume die seinen Ansprüchen gerecht werden Zudem steigt der Druck durch Fressfeinde weiter an EURLebensraum verbessernde Maßnahmen gepaart mit intensiver Fangjagd helfen dem NachwuchsEUR erklärt DJV-Präsidiumsmitglied Helmut Dammann-Tamke weiter Aktuelles Neues Landesjagdgesetz tritt am 28 Mai in Kraft Heute am 27 Mai hat das Land Nordrhein-Westfalen das neue Landesjagdgesetz NRW im Gesetz- und Verordnungsblatt veröffentlicht weiter Aktuelles 107 Seiten gegen den Entwurf für das Landesjagdgesetz 19 01 2015 Dortmund Der Landesjagdverband Nordrhein-Westfalen hat vor der parlamentarischen Anhörung am 22 Januar zum Landesjagdgesetz seine Stellungnahme schriftlich an den Landtag geschickt weiter toggleblock containerid if getElementById containerid style display block getElementById containerid style display none else getElementById containerid style display block Mitgliederlogin Bitte geben Sie Ihre Mitgliedsnummer und Ihr persönliches Passwort ein beim ersten Login ist Ihre PLZ Ihr Passwort dann dieses bitte ändern Mitgliedsnummer Passwort vergessen? Passwortanforderung Wir senden Ihnen einen Link zum Zurücksetzen des Passworts an die in der Datenbank gesicherte und hierunter angegebene Emailadresse zu Email-Adresse Zurück zur Anmeldung Kreisjägerschaften und Hegeringe im LJV Aachen Bielefeld Bochum Borken Bottrop Coesfeld Düren Düsseldorf-Mettmann Dortmund Duisburg Emschergau Ennepe-Ruhr Essen Euskirchen Gütersloh Gelsenkirchen Höxter Hagen Hamm Heinsberg Herford Hochsauerland Jägerschaft Bonn Köln Kleve Krefeld Leverkusen Lippe Märkischer Kreis Mönchengladbach MülheimRuhr Münster Minden-Lübbecke Neuss Oberberg Oberhausen Olpe Paderborn Recklinghausen Remscheid Rhein-Erft Rhein-Sieg Rhein -Berg -Kreis Siegerl -Wittgenstein Soest Solingen Steinfurt-Tecklenbg Unna Viersen Warendorf Wesel Wuppertal kontinentCalendar cal width 100 border-spacing 0px cal td padding 3px width 14 28 calRow td border-bottom thin 007036 solid border-right thin 007036 solid calRow td last-child calRow td first-child border-left thin 007036 solid calRow last-child td border-bottom thin 007036 solid calHead border thin 007036 solid border-left none padding 10px background-color 007036 color FFF calDayEmpty background-color none calDayToday border thin 007036 solid padding 10px background-color 007036 color FFF calDay background-color e5d7cf calEvents background-color FFF calDay hover calDayToday hover background-color bbb dayNum calNavBack text-align left calNavForward text-align right calNavSelect text-align center events padding 20px Das Formular calendarForm padding 20px kontinentCalendar h2 margin-bottom 20px generateCalendar month year kategorie kontinentCalendar empty post templatemodul kalender ajax php month year kategorie data kontinentCalendar append data calendar json showEventDiv id calendarForm hide events show allEvents hide event id show generateCalendar 9 2016 1 Aktuelle Termine 06 09 bis 10 09 Bundesmeisterschaft Liebenau Landesjagdverband Nordrhein-Westfalen e V EUR Gabelsbergerstraße 2 EUR 44141 Dortmund EUR Tel 02312868-600 EUR Fax 02312868-66 eiben mit den Umrissen jagdbarer Tierarten Die Wertung der Schüsse orientiert sich an den inneren Organen Höchste Punktzahl gibt es wenn die Region um Herz oder Lunge getroffen wird Für den Tierschutz ist das regelmäßige Schießtraining entscheidend Optimale Treffer müssen immer unser Anspruch als Jäger sein sagte DJV-Präsidiumsmitglied Dr Jörg Friedmann weiter Alter und neuer LJV-Präsident Ralph Müller-Schallenberg 4 v r Vizepräsidenten Georg Kurella 4 v l und Hans-Jürgen Thies 2 v r Schatzmeister Dr Peter Bottermann 3 v r Hauptgeschäftsführer Christof J Marpmann l sowie die Beisitzer der Regierungsbezirke Jürgen Schulte-Derne Regierungsbezirk Arnsberg 2 v l Dr Heiner Breickmann Regierungsbezirk Köln 3 v l Berthold Antpöhler Regierungsbezirk Detmold 5 v l Franz Josef Schulze Thier Münster r nicht im Bild Gerhard Thomas Beisitzer Regierungsbezirk Düsseldorf Aktuelles Basis bekräftigt Verbandskurs mit dickem Ausrufezeichen Überwältigende Zustimmung für die Verbandspolitik von Landesjagdverbands-Präsident Ralph Müller-Schallenberg im Rahmen der Präsidiumswahlen 2016 25 Juni 2016 AachenDortmund LJV Rund 600 Teilnehmer erlebten am Samstag den 25 Juni in Aachen einen inhaltlich kämpferischen Landesjägertag 2016 der einmal mehr verdeutlichte dass Nordrhein-Westfalens Jäger sich auch zukünftig mit den Verschlechterungen für den Tier- Natur- und Artenschutz durch das neue rot-grüne Landesjagdgesetz und andere ideologisch motivierte Gesetzesvorhaben nicht abfinden werden weiter Intern LJV-Jahresbericht 2015 Klare Worte von Ralph Müller-Schallenberg auf dem Landesjägertag in Schmallenberg Klare Ansage von Jägerpräsident Ralph Müller-Schallenberg am 30 Mai 2015 auf dem Landesjägertag in Schmallenberg zum neuen Landesjagdgesetz EURDer LJV setzt mit seinen Partnern den Kampf in Politik Gesellschaft und vor Gericht so lange fort bis sachlich-fachlich gute Ergebnisse erzielt sind Die nächsten Schritte sind weiter v r n l Dr Tobias Blasius Vorsitzender Landespressekonferenz NRW Hans-Jürgen Thies Justiziar des Landesjagdverbandes NRW Ralph Müller-Schallenberg Präsident des Landesjagdverbandes NRW Christof J Marpmann Hauptgeschäftsführer des Landesjagdverbandes NRW Aktuelles Verfassungswidrig praxisfern gegen Land und Leute Ralph Müller-Schallenberg zieht vorläufige Bilanz nach einem Jahr Landesjagdgesetz Düsseldorf 22 Juni 2016 Ralph Müller-Schallenberg Präsident des Landesjagdverbandes Nordrhein-Westfalen LJV hat heute in Düsseldorf vor der Landespressekonferenz eine niederschmetternde Jahresbilanz des neuen rot-grünen Landesjagdgesetzes gezogen Müller Schallenberg EURDas Landesjagdgesetz ist gegen die gute jagdliche Praxis und bedeutet weniger Artenschutz Es ist verfassungswidrig und richtet sich gegen die Hauptbetroffenen sowie die Mehrheit von Land und Leuten EUR weiter Durch den Präsidenten des LJV Ralph Müller-Schallenberg l und Karl-Heinz Reinke r als für das Brauchtum zuständiges Präsidiumsmitglied wurden Josef und Giesela Füchtenkord für ihren jahrelangen Einsatz ausgezeichnet Aktuelles 30 Landeswettbewerb im Jagdhornblasen Dankeschön Josef Füchtenkord! Unter einem guten Stern stand der diesjährige NRW-Landesbläserwettbewerb der mit rund 1 800 Teilnehmern aus etwa 120 Gruppen am 18 und 19 Juni am Oberen Schloss in Siegen stattfand Zahlreiche Teilnehmer eine tolle Vorbereitung vor Ort und mit einer stimmungsvollen Hubertusmesse unter freiem Himmel am Vorabend des ersten Wettbewerbstages wurde die Grundlage für eine erfolgreiche Veranstaltung gelegt weiter Aktuelles Richter halten Landesjagdgesetz für verfassungswidrig Verwaltungsgericht hat Bedenken gegen Schießnachweis-Regelung EUR Schlappe für Landesregierung weiter Aktuelles 30 Landeswettbewerb im Jagdhornblasen des Landesjagdverbandes Nordrhein-Westfalen Veranstaltungsort Oberes Schloss Siegen Datum Samstag 18 Juni 2016 von 8 bis ca 19 Uhr Sonntag 19 Juni 2016 von 8 bis ca 17 30 Uhr Jagdliches Brauchtum ist die Seele der Jagd 30 Mai 2016 LJV Intro WebFontConfig families Brawler latin src location ? http ajax googleapis comajaxlibswebfont1webfont js type textjavascript async true s getElementsByTagName 0 s parentNode insertBefore s Slider ready Mobile Button mobileButton click screenWidth ljv width -60 if this hasClass open Schliessen this removeClass open ljv animate left 0 500 Animation complete else Öffnen this addClass open ljv animate left - screenWidth 500 Animation complete ul hauptnavigation animate marginleft 0 width screenWidth 500 Animation complete imageList fader speed 300 timeout 7000 popup fancybox fancyThumb fancybox section fancybox Layoutkorrekur Ausführen window onload layout sectionheight getElementById contentall offsetHeight if sectionheight 600 content css min-height sectionheight px Carousel Basic carousel no options foo0 carouFredSel Basic carousel timer foo1 carouFredSel auto pauseOnHover resume onPauseStart percentage duration this trigger configuration width value timer1 stop animate width value duration easing linear onPauseEnd percentage duration timer1 stop width 0 onPausePause percentage duration timer1 stop Scrolled by user interaction foo2 carouFredSel prev2 next2 auto true Jump to KJS jumpToKJS window open getElementById urlKJS value togglevisibility containerid if getElementById containerid style visibility visible getElementById containerid style visibility hidden else getElementById containerid style visibility visible ready accordion collapsible true autoHeight false navigation true heightStyle content ready if socialshareprivacy length 0 socialSharePrivacy css path socialshareprivacysocialshareprivacy css lang path socialshareprivacylang language de gaq push setAccount UA-23379610-1 gaq push trackPageview ga ga type textjavascript ga async true ga src location ? ssl http www google-analytics comga js s getElementsByTagName 0 s parentNode insertBefore ga s Home Impressum AGB Datenschutz Home Intro AktuellesVolksinitiativeWildfleisch aus NRWGegen Ideologie im JagdrechtÜber den LJVUnser WildDie JagdBildergalerieNatur- und WildschutzWILDLernort NaturJäger werdenJunge JägerMitgliederServiceDownloadsJagdparcours Buke GmbHRWJ-OnlineShopPresseKontakt Wildrezept des Monats Grillspieße vom Reh Rot- oder Damwild Ein sommerlicher Genuss für Pfanne und Grill Von Magdalene und Wolfgang Grabitz 33106 Paderborn weiter Spenden Sie einfach was Ihnen die Jagd wert ist! Wenn Sie Ihrerseits noch mehr für die Jagd leisten wollen tun Sie es! Der Landesjagdverband NRW braucht derzeit für seine Aktionen zum Erhalt der Jagd in NRW jeden Cent Unterstützen Sie uns mit Ihrer Spende! weiter Aktuelles Plakataktion - Jetzt auch für Bauzäune Aufgrund der großen Nachfrage gibt es unsere Plakate jetzt auch im Format 340 B x 175 H bestens geeignet für Bauzäune Die passende PDF Datei für Ihre Zwecke finden Sie in unserem Download Bereich als Großplakat 181 oder neu als Bauzaunplakat weiter lesen Quelle DJV Kaphus Aktuelles Chronische Auszehrkrankheit in Skandinavien Was Jäger wissen sollten In Norwegen ist bei einem Rentier und zwei Elchen die aus Nordamerika stammende chronische Auszehrkrankheit CWD nachgewiesen worden Behörden zufolge könnte der Erreger durch Hirsch-Urin aus den USA importiert worden sein Wie gefährlich die Wildtierkrankheit ist und was deutsche Jäger wissen müssen fasst der DJV zusammen Ein Rentier und zwei Elche sind in Norwegen bereits an CWD erkrankt Quelle KapuhsDJV 24 August 2016 djv Berlin In Norwegen sind bereits drei Fälle der aus Nordamerika stammenden chronischen Auszehrkrankheit nachgewiesen worden Dabei handelt es sich um ein Rentier und zwei Elche Den Norwegischen Behörden zufolge wird aus den USA importierter Hirsch-Urin als mögliche Primärquelle vermutet Daher wiesen die Europäische Kommission und das Bundeslandwirtschaftsministerium BMEL auf das Importverbot von Hirsch-Urin in die EU hin weiter Aktuelles Gastbeitrag zur EU-Feuerwaffenrichtlinie Keine Einschränkungen für Jäger u Daten aus rund 450 Referenzgebieten im Rahmen des Wildtier-Informationssystems der Länder Deutschlands WILD Vorsichtige Hochrechnungen ergeben In Deutschland leben derzeit rund 3 bis 3 5 Millionen Feldhasen - auf 25 Bundesbürger kommt also ein Osterhase Die Bestände des Feldhasen sind seit Beginn der bundesweiten Erfassung im Jahr 2002 trotz leichter Schwankungen stabil weiter Aktuelles Entwurf Bundesjagdgesetz-Novelle liegt vor 03 03 2016 DJV Das Bundeslandwirtschaftsministerium hat gestern einen Entwurf für die Novellierung des Bundesjagdgesetzes auf den Weg gebracht Dieser zielt im Kern darauf ab für Jagdmunition sowie für den Schießübungsnachweis bundesweit einheitliche Regelungen festzulegen Der Deutsche Jagdverband DJV begrüßt diesen Schritt in einer ersten Reaktion EURDer Entwurf ist im Grundsatz positiv zu bewertenEUR sagte DJV-Präsident Hartwig Fischer Es gebe jedoch noch Inhalte die im Detail geprüft werden müssten so Fischer Der Entwurf zur Änderung des Bundesjagdgesetzes EURBJagdGEUR steht jetzt unter http bit lyJagdgesetz zum Herunterladen bereit Ralph Müller-Schallenberg Aktuelles Beim Bundesjagdgesetz stimmt die Richtung LJV-Präsident Müller-Schallenberg Chance für bundeseinheitliche Regelungen nutzen 26 Februar 2016 LJV-NRW EURBeim Bundesjagdgesetz geht es in die richtige Richtung die geplanten Änderungen bedürfen aber im Detail noch klarstellender juristischer Feinarbeit EUR Mit diesen Worten hat Ralph Müller-Schallenberg Präsident des Landesjagdverbandes Nordrhein-Westfalen in einer ersten Reaktion den Referentenentwurf der Bundesregierung zur Änderung des Bundesjagdgesetzes kommentiert weiter Was ist Jagd und was machen Jäger? Aktuelles EU-Waffenrechtlinie Deutschland als Maßstab Debatte um Waffenrecht-Verschärfung nimmt Fahrt auf 19 02 2016 Gastkommentar von Karl-Heinz Florenz CDU-Europaabgeordneter und Präsident der Jagd-Intergruppe im Europäischen Parlament Die Debatte um den Vorschlag der EU-Kommission zur Überarbeitung der sog Feuerwaffenrichtlinie nimmt spürbar Fahrt auf Die Europäische Kommission hat seit mehreren Jahren an einer Revision der Richtlinie gearbeitet und für das Frühjahr 2016 einen neuen Vorschlag angekündigt Aufgrund der Attentate in Frankreich war der politische Handlungsdruck jedoch so hoch dass im November 2015 überstürzt ein neuer Vorschlag vorgelegt wurde Viele wenn auch nicht alle Vorschläge wurden mit heißer Nadel gestrickt Falsch ist meines Erachtens die europaweite Regelung von legalen Waffen mit dem Argument der Terrorismusbekämpfung zu begründen Ich sehe keinen Zusammenhang zwischen dem legalen Besitz ziviler Waffen wie sie für die Jagd oder den Schießsport verwendet werden und terroristischen Attentaten weiter Aktuelles 10 Prozent mehr Wildschweine erlegt DJV legt Statistik für das Jagdjahr 201415 vor Berlin 03 Februar 2016 Die Jäger haben in Deutschland in der vergangenen Jagdsaison April 2014 bis März 2015 über 520 000 Wildschweine erlegt Das sind 10 Prozentpunkte mehr als noch im Jahr zuvor und 70 Prozentpunkte mehr als vor 25 Jahren Von anderen heimischen Paarhufern haben die Jäger weniger Tiere erlegt als im vorangegangenen Jagdjahr Im Vergleich zu 1990 stieg die Zahl jedoch ebenfalls beim Rotwild um 17 beim Damwild um 79 und beim Rehwild um 23 Prozentpunkte Die steigenden Abschusszahlen sind kein deutsches sondern ein mitteleuropäisches Phänomen Nach Angaben des Thünen-Instituts in Eberswalde hat sich in Zentraleuropa die Zahl der erlegten Hirsche Wildschweine und Rehe in 40 Jahren sogar verdreifacht Die Ursachen seien komplex so die Forscher Mehr Nahrung und Lebensraum seien aber die Hauptgründe weiter Intro - Lernort Natur 25 Jahre Lernort Natur Spiel Spaß Spannung und jede Menge Infos über unsere heimische Flora und Fauna - all das bietet Lernort Natur seit 25 Jahren Die Initiative der Jäger hat in NRW ihren Ursprung und wurde mehrfach von der UNESCO im Rahmen der UN-Dekade Bildung für nachhaltige Entwicklung BNE ausgez nd Sportschützen MdEP Schwab und Pieper Bestehende Regelungen für legale Waffenbesitzer in Deutschland bleiben erhalten Der Binnenmarktausschuss des Europäischen Parlaments habe den EU-Kommissionsvorschlag für die Feuerwaffenrichtlinie deutlich entschärft 24 August 2016 DJV Berlin Die von der Kommission initiierte Verschärfung des EU-Waffenrechts wird in Deutschland nur geringe Auswirkungen haben Der Binnenmarktausschuss des Europäischen Parlaments hat am 13 Juli 2016 für eine entsprechende Entschärfung des EU-Kommissionsvorschlags gestimmt weiter Aktuelles Plakataktion EUR gemeinsam für die Jagd und gegen Vorurteile Rund 150 Plakatwände mit monatlich wechselnden Motiven stehen bereits in NRW um das Zerrbild von Jagd und Jägern wieder geradezurücken das interessierte Kreis in den vergangenen beiden Jahren aufzubauen versucht haben Aufgestellt und betrieben werden sie von unseren Kreisjägerschaften Hegeringen und engagierten Einzelpersonen Und es sollen noch mehr werden Kreisjägerschaften und Hegeringe können die Plakate in unserem Shop kostenlos bestellen Außerdem stehen für Interessierte alle Plakate als Download zur Verfügung weiter Aktuelles Die nächste juristische Pleite für das Landesjagdgesetz OVG Münster Gemeinden müssen Fundkatzen annehmen EUR Erneute Schlappe für Landesregierung 04 August 2016 Dortmund LJV Die nordrhein-westfälische Landesregierung tappt mit ihrem umstrittenen Landesjagdgesetz von einer juristischen Falle in die nächste Nun stellt sich heraus dass die Städte und Gemeinden eine Folge ausbaden müssen mit der sie nie gerechnet haben und für die sie nicht gerüstet sind Denn das Oberverwaltungsgericht Münster hat soeben entschieden dass die kommunalen Fundbüros Katzen annehmen müssen die ihnen von Jägern als Beifang in Lebendfangfallen gebracht werden Aktenzeichen 5 B 126515 EUR 1 L 129015 Münster weiter Quelle KapuhsDJV Aktuelles Selbstladebüchsen mit Wechselmagazin weiter erlaubt Der Bundestag hat heute eine Änderung des Bundesjagdgesetzes beschlossen Demnach dürfen halbautomatische Waffen mit Wechselmagazin weiterhin bei der Jagd eingesetzt werden solange nicht mehr als drei Patronen geladen sind Der Bundesrat kann dazu allerdings frühestens im September beschließen Der Deutsche Jagdverband DJV fordert deshalb eine entsprechende Stellungnahme der Regierungen von Bund und Ländern die unmittelbare Rechtssicherheit für Jäger schon vor dem Inkrafttreten der Novelle schafft Berlin 08 Juli 2016 Der Bundestag hat heute die angekündigte kleine Novelle wir berichteten www jagdverband de des Bundesjagdgesetzes beschlossen um die Verwendung von Selbstladebüchsen mit wechselbarem Magazin weiterhin zu ermöglichen Der DJV begrüßt diese Klarstellung und insbesondere die schnelle Reaktion des Gesetzgebers Die Regelung in 19 Bundesjagdgesetzes soll künftig lauten EURVerboten ist EUR mit halbautomatischen Langwaffen die mit insgesamt mehr als drei Patronen geladen sind sowie mit automatischen Waffen auf Wild zu schießen EUR weiter Quelle GrimmDJV Aktuelles Jäger halten sich fit für die Jagd Repräsentative DJV-Befragung zeigt Neun von zehn Jägern gehen regelmäßig auf den Schießstand oder ins Schießkino davon über die Hälfte jährlich dreimal und mehr Auch sonst bilden sich Waidfrauen und -männer aktiv fort Knapp 27 000 Verbandsmitglieder haben im vergangenen Jahr allein an Fachveranstaltungen und Schulungen der Landesjagdverbände und des DJV teilgenommen Darunter zahlreiche Multiplikatoren Berlin 27 Juni 2016 Der Deutsche Jagdverband DJV hat heute weitere Daten aus der aktuellen Jäger-Umfrage veröffentlicht Demnach trainiert jeder Jäger durchschnittlich etwa siebenmal jährlich mit seiner Waffe Neun von zehn Jägerinnen und Jägern gehen dafür regelmäßig auf den Schießstand oder ins Schießkino davon über die Hälfte dreimal und mehr Dort werden beispielsweise anhand von Videosequenzen Situationen für die herbstlichen Bewegungsjagden geübt sowie Schüsse im Stehen oder Sitzen auf Sch

ljv-nrw.de | | 1. PR-Navi.de ljv-nrw.de
2. ljv-nrw.de PR-Navi.de

| schen Umweltministerium brachte der Landes-jagdverband Rheinland-Pfalz LJV die aktualisierte Broschüre Verantwor-tungsvolle Bewirtschaftung des Rotwildes Rheinland-Pfalz und heraus weiterHier können Sie die Broschüre und Verantwortungsvolle Bewirtschaftung des Rotwildes Rheinland-Pfalz und herunterladen Foto LJV RLP Wildunfallzahlen gestiegen Wildunfälle ereigneten sich Rheinland-Pfalz Vergleich zum Vor-jahr Wildunfälle bedeutet das einen Anstieg von Prozent Der Landesjagdverband Rheinland-Pfalz LJV warnt zudem vor erhöhter Wildunfallgefahr nach der Zeitumstellung Ende März weiter Foto LJV RLP Sonderkonditionen für Mitglieder des LJV Rheinland-Pfalz10 Rabatt auf Saatgut der Firma Saaten ZellerDer Rabatt ist sofort bis zum Ende des Jahres gültig Einfach bei der Bestellung den Rabattcode rlp2016 und die Mitgliedsnummer angeben Gute Feldhasenbesätze Rheinland-Pfalz Herbst lebten rheinland-pfälzischen Feldern und Wiesen durchschnittlich Hasen pro Quadratkilometer Vergleich haben sich die Feldhasenbestände nahezu verdoppelt weiter Foto Eduard Henß Aujeszkyschen Krankheit und Das Landesuntersuchungsamt hat ein neues Merkblatt zur seltenen Aujeszkyschen Krankheit veröffentlicht weiter Foto Günther Klein Frühjahrsputz jagdlichen EinrichtungenWildmeister und akademischer Jagdwirt Christoph Hildebrandt erklärt was ihr alles beim Frühjahrsputz Revier beachten solltet weiter Foto Achim Goedert Schalldämpferregelung gelockert Erfolg für den Landesjagdverband Rheinland-Pfalz LJV Jägerinnen und Jäger können nun einfacher Schalldämpfer für die Jagd erwerben Nach monatelangen Bemühungen des LJV hat das rheinland-pfälzische Innenministerium eine pragmatische Genehmigungsregelung auf dem Weg gebracht weiter Foto LJV RLP NABU und Landesjagdverband Gespräch Mitte Januar trafen sich die Spitzen der Naturschutzverbände NABU Rheinland-Pfalz und Landesjagdverband Rheinland-Pfalz LJV zum Dialog Beim Gespräch zwischen den Verbandsspitzen Siegfried Schuch NABU und Kurt Alexander Michael LJV ging Gemeinsamkeiten und zukünftigen Kooperationen weiter Foto LJV RLP Jetzt anmelden Breites Fortbildungsangebot der LJV-LandesjagdschuleÜbersicht Seminare der LJV-Landesjagdschule Foto LJV RLP zur Reduzierung überhöhter SchwarzwildbeständeHier können Sie das Handlungsprogramm als PDF direkt herunterladen Foto Sabine Hochhäuser Für alle die ihre Trophäen bewerten wollen stellt der Landesjagdverband Rheinland-Pfalz Trophäenbewertungsbögen für Rehböcke mit Bewertungsrichtlinien Rothirsche Damhirsche Muffelwidder und Keiler zur Verfügung Foto LJV RLP Meldebogen zur Erfassung von Schlagopfern WindkraftanlagenDer LJV ruft Zusammenarbeit mit dem Naturhistorischen Museum Mainz Landessammlung für Naturkunde und dem Landesamt für Umwelt Wasserwirtschaft und Gewerbeaufsicht Rheinland-Pfalz zur Erfassung von Schlagopfern Windkraftanlagen auf weiter Foto Ludwig Neuhold Landesbetrieb Mobilität R iederbesiedlung und das Management des Luchses bei Konflikten erarbeiten haben sich gelohnt weiterHier können Sie den Luchs-Managementplan herunterladen Foto LJV RLP DJV-Nachricht Mit Bürokratie gegen Terrorismus EU-Ministerrat positioniert sich zur Änderung der Feuerwaffenrichtlinie weiter Foto DJV DJV-Nachricht Koalition einigt sich auf neues Bundesjagdgesetz Durchbruch bei Verhandlungen der Regierungsfraktionen Rechtssicherheit für halbautomatische Jagdgewehre weiter Foto DJV Gemeinsame Pressemeldung Landwirte und Jäger helfen gemeinsam den Rehkitzen Der Bauern- und Winzerverband Rheinland-Nassau der Landesjagdverband Rheinland-Pfalz und die Interessengemeinschaft der Jagdgenossenschaften und Eigenjagdbesitzer IGJG präsentierten auf dem Betrieb Mallmann Rhens gemeinsam den Einsatz technischer Wildretter weiter Foto LJV RLP Effektive Gänsebejagung Vortrag des Wasserwildexperten Sven LübbersDie Gänsepopulationen nehmen landesweit deutlich und ebenso wie die von Gänsen verursachten landwirtschaftlichen Schäden Das Umweltministerium tritt daher zusammen mit dem LJV dieser Problematik mit dem praxisgerechten Fachvortrag Effektive und zeitgemäße Bejagung von Gänsen und Juni Bingen-Dietersheim und Juni Hatzenbühl entgegen weiter Foto LJV RLP Wilde Sommer-Kochkurse Jahr Die Wilden Sommer-Kochkurse und gehen die zweite Runde Nach dem Erfolg der Initiative Sommer veranstaltet der Landesjagdverband Rheinland-Pfalz LJV Zusammenarbei ine Besitz-Erlaubnis widerruft sollten Betroffene hiergegen klagen weiter Foto DJV DJV-Nachricht Urteil halbautomatischen Waffen sorgt bei Jägern für Unverständnis Das Bundesverwaltungsgericht hat ein Urteil mit wechselbaren Magazinen gefällt das für Diskussion der Jägerschaft sorgt Der DJV kritisiert diese Entscheidung auf das Schärfste verweist auf inhaltliche Mängel des Urteils und äußert verfassungsrechtliche Bedenken weiter Foto DJV Wildschäden auf Grünlandflächen durch SchwarzwildLandesweit war die Einzeljagd auf unsere Schwarzkittel durch das Mastjahr und den bis dato weitestgehend fehlenden Schnee deutlich erschwert Mit erhöhten Grünlandschäden durch Schwarzwild war somit rechnen und Wiesen auf denen Braun über Grün dominiert sind daher diesen Tagen dann auch keine Seltenheit Wildmeister Christoph HIldebrandt gibt Tipps zur Wildmeister Christoph Hildebrandt gibt Tipps zur Berechnung und zum Beheben von Schäden weiter Foto LJV RLP Junge Schützen gesuchtDer Landesjagdverband Rheinland-Pfalz fördert die Jugendarbeit jagdlichen SchießenIn einer bis dahin nie dagewesenen Aktion bringt der Landesjagdverband Rheinland-Pfalz LJV allen interessierten Jägerinnen und Jägern Alter zwischen und Jahren das jagdliche Schießen näher Auf ausgewählten Schießstätten finden vom April bis Mai vier kostenfreie Schnupperkurse statt weiter Foto LJV RLP Empfehlungen zur Rotwildbewirtschaftung neu aufgelegt Gemeinsam mit dem rheinland-pfälzi Landesjagdverband Rheinland-Pfalz Projekt suchen Jagdschule Seibt Jagdhaftpflichtversicherung Unsere Partner LIFE-Projekt Luchs Playstore Einsatz von Wildkameras erlaubt 09 Für die Jägerschaft besteht sofort Rechtssicherheit beim Einsatz von Wildkameras Der Landesjagdverband Rheinland-Pfalz LJV und der Landesbeauftragte für und Informationsfreiheit Rheinland-Pfalz LfDI einigen sich auf Richtlinien für den Einsatz der Wildbeobachtungs-Technik weiterHier finden Sie die vollständigen gemeinsamen Richtlinien zum Einsatz von Wildkameras Foto LJV RLP Nochmal Wild auf den Grill Der Sommer zeigt noch einmal was kann Mit Temperaturen die Grad Celsius ist die Grill-Saison noch lange nicht vorbei Jetzt können Grill-Fans die Gelegenheit nutzen schmackhaftes Wildfleisch auf den Rost legen weiter Foto DJV Pressemeldung Stiftung Natur und Umwelt Rheinland-Pfalz Luchse unterwegs!Luna Kaja und Lucky erschließen sich ihren Lebensraum Pfälzerwald Die drei Luchse wurden Juli freigelassen Nachdem sie zunächst ihre unmittelbare Umgebung erkundet haben erweitern die Tiere ihren Bewegungsradius weiter Foto LJV RLP Wichtige Änderung UmsatzsteuergesetzJagdgenossenschaften können künftig der Umsatzsteuerpflicht unterliegenEine Anpassung europäisches Recht führt dazu dass die Verpachtung eines gemeinschaftlichen Jagdbezirks unter Umständen umsatzsteuerpflichtig sein kann Die Jagdgenossenschaften sind weitgehend informiert Auch der Jagdpresse wurden ve heinland-PfalzAnbringung von Wildwarnreflektoren Leitpfosten Zuge von Bundes- Landes- und Kreisstraßen Rahmen der sonstigen Nutzung Abs LStrG bzw Abs FStrG hier Farbe der Reflektoren weiß rot blau oder blau-weiß weiter IMPRESSUM Landesjagdverband Rheinland-Pfalz Egon-Anheuser-Haus Gensingen Postfach Tel Fax Landesjagdverband Rheinland-Pfalz Anerkannter Naturschutzverband Einsatz von Wildkameras erlaubt Nochmal Wild auf den Grill Pressemeldung Stiftung Natur und Umwelt Rheinland-Pfalz Luchse unterwegs! Wichtige Änderung Umsatzsteuergesetz Die Pinselohren kehren zurück Erste Luchse Pfälzerwald freigelassen DER LJV ÜBER UNS PRÄSIDIUM GESCHÄFTSSTELLE PARTNER JUNGE JÄGER LANDESJAGDSCHULE BERATUNGSSTELLE LEHRREVIER SATZUNG DISZIPLINARORDNUNG HEGERINGSTATUT RESOLUTIONEN MITGLIEDSCHAFT HEGEGEMEINSCHAFTEN INFOMATERIAL KONTAKTANFAHRT AKTUELLES ARCHIV NIEDERWILDSYMPOSIUM WILDER SOMMER-KOCHKURS TERMINE SEMINARE FOTOARCHIV ADRESSBUCH KREISGRUPPEN JAGDVERBÄNDE JAGDBEHÖRDEN INSTITUTE JADGPRESSE ANDERE VERBÄNDE JAGDPRAXIS SCHIEßWESEN JAGDHUNDEWESEN BRAUCHTUM JAGDRECHT LEHRREVIER WEINSHEIM REVIERLOSE JÄGER JAGDZEITEN ERLEBNISSCHULE WILDSCHÄDEN JAGDAUSBILDUNG JAGDSTRECKE INFOPLATTFORM LIFE-PROJEKT LUCHS LERNORT NATUR WILDBRETINITIATIVE FORUM WAFFENRECHT WILDTIERMONITORING NATUR MENSCH FÖJ WALDPÄDAGOGEN Begin JCarousel ready Karussell2 jcarousel visible vertical auto 7 wrap circular showCaption true showNavigation hover fit true End JCarousel reinzelt schon entsprechende Hinweise veröffentlicht was geht konkret? weiter Foto LJV RLP Die Pinselohren kehren zurück Erste Luchse Pfälzerwald freigelassenAm Juli wurden die ersten drei von insgesamt Luchsen Pfälzerwald freigelassen Diese Aktion die der Landesjagdverband von Anfang fachlich begleitet hatte trägt zum Schutz und Erhalt einer gefährdeten Leitart und einer weiteren Akzeptanz des jägerischen Handelns bei und erklärte LJV-Vizepräsident Gundolf Bartmann weiter Foto Stiftung Natur und Umwelt RLP Vierbeiniger Autofan mit Neigung zur Eifersucht als Speisekammer Schlafplatz oder Aussichtsplattform Steinmarder fühlen sich und auf Autos tierisch wohl Doch sein Faible für PKW macht den flinken und anpassungsfähigen Jäger bei Autofahrern unbeliebt weiter Foto DJV Erich Pelz siegt bei der Landesmeisterschaft jagdlichen Schießen Erich Pelz aus Nierstein bei Mainz ist neuer Landesmeister jagdlichen Schießen Mit von möglichen Punkten setzte sich einem spannenden Wettkampf gegen die Konkurrenz durch Die Landesmeisterschaft jagdlichen Schießen fand vom bis Juli Kastellaun statt weiterHier finden Sie Ergebnisse und Impressionen Foto LJV RLP Tierischer Liebesrausch gefährdet Straßenverkehr Blind vor Liebe und scheinen Rehe zwischen Mitte Juli und Mitte August sein Denn diesem Zeitraum erreicht die Paarungszeit beim Rehwild ihren Höhepunkt Für Verkehrsteilnehmer gilt jetzt erhöhte Aufmerksamkeit denn besteht akute Ge-fahr durch Wildunfälle weiter Foto Marco Schütte Wer ist der beste Jagd-Schütze Rheinland-Pfalz? Vom bis Juli treten Kastellaun die besten Jagdschützen Rheinland-Pfalz beim Landeswettbewerb jagdlichen Schießen des Landesjagdverbandes Rheinland-Pfalz LJV gegeneinander weiter Foto LJV RLP DJV-Nachricht Selbstladebüchsen mit Wechselmagazin weiter erlaubt Der Bundestag hat heute eine Änderung des Bundesjagdgesetzes beschlossen Demnach dürfen halbautomatische Waffen mit Wechselmagazin weiterhin bei der Jagd eingesetzt werden solange nicht mehr als drei Patronen geladen sind Der Bundesrat kann dazu allerdings frühestens September beschließen weiter Foto DJV Gänsebejagung Landesjagdschule und Beratungsstelle unterstützen JagdpächterIn vielen Teilen Deutschlands sind die Besätze von Wildgänsen bereits hoch dass viel Geld zur Schadensregulierung ausgegeben wird wenngleich sie keine wildschadensersatzpflichtige Wildarten sind Der LJV bietet Hilfe und Beratung weiter DJV-Nachricht Seehofer torpediert große Novelle des Bundesjagdgesetzes Der Bayerische Ministerpräsident Horst Seehofer kippt letzter Sekunde nach Gutsherrenart den Kompromiss von CDU CSU und SPD zur großen Novelle des Bundesjagdgesetzes weiter Foto DJV Luchs-Managementplan ist Das rheinland-pfälzische Umweltministerium stellte Freitag Juni den Luchs-Managementplan vor Die erheblichen jahrelangen Anstrengungen des Landesjagdverbandes Rheinland-Pfalz LJV eine gute Grundlage für die W t mit handverlesenen Restaurants Rheinland-Pfalz Juni wilde Sommer-Kochkurse Kochbegeisterte können lernen wie leicht die Wild-Sommer-Küche zubereitet werden kann weiter DJV-Meldug Zählen für den Artenschutz Rheinland-Pfalz intensivieren die Jäger ihre Bemühungen den Schutz des Rebhuhns perdix Sie starteten diesem Jahr ein Deutschland bisher einmaliges flächendeckendes Monitoring Der DJV war mit einem Filmteam vor Ort weiter Foto DJV Ehrenpreis für Natur- und Umweltschutz Das ehrenamtliche Engagement von Jägern Naturschützern und Förstern BUND- Projekt Wildkatzensprung und erhält anlässlich der Jahreshauptversammlung des Landesjagdverbandes Rheinland-Pfalz LJV den Ehrenpreis für Natur- und Umweltschutz weiter Foto LJV RLP Rheinland-Pfalz hat eine neue Jagdkönigin Sarah Wirtz aus Trier ist neue rheinland-pfälzische Jagdkönigin Anlässlich des Landesjägertages Worms tritt sie ihre zweijährige Amtszeit Für die Doktorandin Fach Biogeographie ist die Jagd ein Zurück zur Natur und verbunden mit einer sinnvollen Aufgabe weiter Foto LJV RLP Landesjägertag Resolution Wildtierkorridoren und Fortschritte beim Wildschutzprogramm Feld und Wiese und Der Landesjagdverband Rheinland-Pfalz LJV verabschiedet auf seiner Jahres- hauptversammlung Worms eine Resolution Wildtierkorridoren und Querungshil- fen Zudem nimmt der Verband mit der Implementierung eines Beratungssystems für Landwirte und Jäger den Kampf gegen den drohenden Artenschwund Of fenland auf weiterHier finden Sie die Resolution Wildtierkorridoren und Querungshilfen Foto LJV RLP DJV nimmt Stellung zur Bundesjagdgesetz-NovelleAnlässlich der gestrigen Verbändeanhörung zur geplanten Novelle des Bundesjagdgesetzes Bundeslandwirtschaftsministerium BMEL hat der Deutsche Jagdverband DJV eine Stellungnahme abgegeben Fazit Verbesserung wichtigen Punkten notwendig weiter Hier finden Sie den Novellierungsentwurf zum neuen Bundesjagdgesetz Foto DJV DJV-Nachricht Halbautomatische Waffen Verbände fordern Klarstellung Kriminalisierung legaler Waffenbesitzer wird nicht hingenommen Der Deutsche Jagdverband DJV und fünf weitere Verbände fordern Klarheit weiter Foto DJV Gemeinsame Pressemeldung Wir machen gemeinsam Tierschutz Die Kreisgruppe Bitburg-Prüm Landesjagdverband Rheinland-Pfalz LJV der Bauern- und Winzerverband Rheinland-Nassau Kreisverband Bitburg-Prüm und der Maschinenring Bitburg-Prüm starten eine Allianz für mehr Tierschutz bei der Wiesenmahd Ein regionales Pilotprojekt mit akustischen Wildrettern soll unzähligen Wildtieren das Leben retten weiter Foto LJV RLP DJV-Nachricht Verunsicherung bei Behörden und Jägern wächst Der DJV veröffentlicht Hinweise für Besitzer halbautomatischer Waffen mit Wechselmagazin Eindeutig ist derzeit nur dass Jäger die einen Halbautomaten der Waffenbesitzkarte haben diesen legal besitzen Der DJV rät jedoch diesen nicht auf der Jagd oder dem Schießstand führen Wenn die Behörde e

| ljv-rlp.de
Sex xXx fick Erotik sexy hardcore
Willkommen auf der Homepage des Landesjagdverbandes Rheinland Pfalz e V
Bildung Schulen Unterricht Uni Allg Weiteres Sonstiges Wettbewerbe Wissenschaft Umwelt Natur Naturschutz Wasser Büro Betrieb Gewerbe Akten Dokumente Schreibdienste Unternehmensberatung Verwaltung Management Consulting Umweltschutz Unternehmenssoftware ERP Haus Heim Garten Nach Raum Ort Arbeitsplatz Küche Landwirtschaft Technik Agrochemie Aquakultur Astronomie Bauernhöfe Bio Biotechnologie Energietechnik Erdbeben Forstwirtschaft Gartenschauen Gärtnereien Geologie Erde Boden Flüsse Gartenbau Gewässer Grünlandwirtschaft Höhlen Holzwaren Landhandel Nationalparks Naturkatastrophen Organisationen Pflanzenwelt Seen Steinmetze Wald Windenergie Landtechnik Produktionsmittel Saatgut Tierhaltung Hunde Katzen Schafe Wild Wilde Tiere Informationen Benzin sparen Bodenschutz Altlasten Gewässerschutz Globaler Wandel Immissionsmessungen ISO Katastrophenschutz Klimaschutz Lärmschutz Luftqualität Modellprojekte Nachhaltigkeit Naturfotografen Ökologie Ozonschicht Tierschutz Umweltanalytik Umweltforschung Umweltgerechtes Bauen Umweltpolitik Umweltrecht Umweltverträglichkeit Umweltwissenschaften Verkehr Vulkane Wälder Wetter Meteorologie Untersuchungslabors Abwasser Medien Nachrichten Thema Versicherungen Hausrat Pflichtversicherungen WeitereSeiten Maschinen Teile | 1. PR-Navi.de ljv-rlp.de
2. ljv-rlp.de PR-Navi.de

ljv-sh.de | |
Bildung Schulen Unterricht Uni Weiteres Wissenschaft Umwelt Natur Naturschutz Wasser Sparen Sport Fitness Spaß Schießsport Jagd Jagen WeltderFrau
Sex xXx fick Erotik sexy hardcore

r WildunfälleEUR warnt der Präsident des Landesjagdverbandes Schleswig-Holstein Wolfgang Heins die Autofahrer Aktuell ist Weiterlesen Aktiv werden Mitglied werdenNewsletter abonnieren Mond Nächster Vollmond Freitag Nächster Neumond Samstag von Foxsoft Termine Seminar für Rhetorik abgesagtBeginn Seminarräumen des Schießsportzentrum Kasseedorf www ssz-kasseedorf Seminar EURWildbrethygiene vom Revier stelle für Weiterlesen Jäger zur Durchführung unseres Wildkameraprojektes für Schüler oberer Klassen gesuchtBekanntermaßen gehört die Forderung die Schule nach ständig steigenden ökologischen Kenntnissen und ausreichender Umweltbildung der Schüler zum Standardprogramm von Weiterlesen Wenn die Rehe Hochzeit halten steigt die Gefahr der WildunfälleEURWenn die Rehe Hochzeit halten steigt die Gefahr de Mannschafts- Weiterlesen Ich will Jäger werden!Das haben sich Jugendliche aus ganz Schleswig-Holstein vorgenommen und sich für den Kompaktvorbereitungskurs der jugendPROnatur und der Jagdschule Husum angemeldet Seit dem Weiterlesen RingfunderfassungLiebe Flugwildjäger Wasserwildjäger Gänsejäger und Jägerinnen!In Kooperation mit dem Landesjagdverband Schleswig-Holstein gibt nun eine zentrale Sammel ndesjagdverbandes Schleswig-Holstein gibt viel entdecken aktuelle Informationen aus dem Verband Termine und Veranstaltungstipps viel Wissenswertes zum Naturschutz und zur Jagd Schleswig-Holstein und vieles mehr Auch ein Blick unseren LJV-Shop lohnt sich Viel Spaß beim Stöbern auf unseren Seiten Naturerlebnistag Mölln dem Motto EURLand schafft LebenEUR lädt das Naturparkzentrum Uhlenkolk insbesonder rbeit angeboten EUR weitere Schritte werden von der Kreisjägerschaft geprüftKreis Pinneberg Ein Jäger der Kreisjägerschaft Pinneberg der sogar Weiterlesen Achtung Frist nicht verpassen EUR Jagdverpachtung bald Umsatzsteuerpflichtig?Durch eine Änderung des Umsatzsteuerrechts müssen Körperschaften des öffentlichen Rechts EUR denen auch Jagdgenossenschaften zählen EUR dem für viele Geschäfte Weiterles Herzlich willkommen rightCollapseDefault show excludeModules 38 ja-header ja-mainnav ja-container ja-botsl ja-footer margin auto ja-wrapper Zum Inhalt wechseln Zur Hauptnavigation Zur ersten Spalte Zur zweiten Spalte parseInt Aktuellesaus dem Landaus den dem DJVVeranstaltungenLandesjagdverbandJagdliches und für JägerLinksDownloads Werde FAN RSS Feeds Herzlich willkommen auf der Internetseite des La bis zur LadenthekeEURBeginn Treffpunkt Waidmannsruh Horst GrönwohldhorstJahreshauptversammlung KreisbläserobleuteBeginn Gasthof Lafrenz Hamdorf Osterende Ansprechen von DamhirschenBeginn Naturparkzentrum Uhlenkolk Waldhallenweg MöllnJugendbläserfreizeitBeginn Wildpark EekholtJuLeiCa Block Jugendherberge HeideJunge-Jäger EUR Schießen Schießstand Wolfsberg HasenmoorHartenholmFallenjagdseminarBeginn G e Familien zum Naturerlebnistag ein Rund verschiedene Aussteller bieten ein Weiterlesen Neue Mitglieder bei jugendPROnatur Der Anteil jungen Frauen steigt EUR Marlene ist eine von ihnen!Marlene Höfs strahlt sie hat geschafft sogar als Beste des Kurses Die Prüfungen sind bestanden den Weiterlesen Landesjägerschaft verurteilt Tötung eines Jagdhundes durch einen JägerErmittlungsbehörden wird Zusammena en röhrt wieder!Damit sind keine leistungsstarken Motoren gemeint sondern die Rothirsche die mittels Brunftlauten dem sogenannten Röhren die Damenwelt von sich überzeugen wollenFlintbek Weiterlesen Landesmeisterschaften der Junioren jagdlichen Schießen HeideAm Juni fand auf dem Schießstand Heide die Landesmeisterschaft der Junioren jagdlichen Schießen statt wurden die Landesmeister der Junioren der ut BasthorstJagdrecht und Naturschutzrecht zwei Rechtskreise Konflikte und Chancen Beginn Bildungszentrum für Natur Hamburger Chaussee Flintbek Telefon Fax E-Mail anmeldung bnur landsh Homepage www bnur schleswig-holstein deLandesparcoursschießen Büchse Beginn Schießstand Heede Pinneberg weitere Downloads Jäger Liste der Nachsuchegespanne Jäger 032016 KontaktImpressumFAQ sLoginMitgliederverwaltung
Landesjagdverband Schleswig Holstein e V Zusammenschluss der J gerinnen und J ger und weiterer Natursch tzer | 1. PR-Navi.de ljv-sh.de
2. PR-Navi.de ljv-sh.de

Bildung Wissenschaft Archäologie Biologie Chemie Geistesw Ethik Geologie Informatik Angewandte Forschungseinrichtungen Projekte Forschungsförderung Geschichte Organisationen Persönliche Seiten Software Technische Theoretische Wissenschaftler Personen Sonstiges Ingenieur Technik Mathematik Medizin Physik Psychologie Umwelt Natur Weitere Wissensgebiete Energieversorgung Ressourcen Medien Nachrichten Informationen
ljbw.de | |
Sex xXx fick Erotik sexy hardcore | | sich alles Experimente mit Licht all seinen Facetten Nachmittag lautet das Motto Licht aus! Hier erfahren die Teilnehmenden alles Wissenswerte zur Lichtmalerei weiterlesen Ausbildung zum zur Experimentiertrainer inKinder sind von Natur aus kleine Forscher und Entdecker Sie dieser Neugier stärken und unterstützen ist nicht nur Aufgabe des Elternhauses oder der Schule Auch Kindertagesstätten bei Tagesmüttern und EUR vätern s rfahrungsberichte unserer Freiwilligen Ausland KINDER- UND JUGENDHAUS INSEL VERANSTALTUNGSKALENDER SPENDE und EHRENAMT Landesverband Sächsischer Jugendbildungswerke e Kontakt Landesverband Sächsischer Jugendbildungswerke e Cossebauder Straße Dresden Telefon Telefax E-Mail info ljbw ImpressumDatenschutzAGB Der LJBW und seine Veranstaltungen werden gefördert vom Sächsischen Staatsministerium für Soziales und Verbraucherschut ikel Veranstaltungen Projekten und Wissenwertem finden Sie der Rubrik Aktuell Das Wissenschaftsjahr Das Jahr des Lichts und die EURStadt der Zukunft haben deutschlandweit und international viele spannende Projekte und Veranstaltungen entstehen lassen Und auch diesem Jahr werden die offiziellen Themen der Wissenschaftsjahre der breiten Öffentlichkeit erneut interessante Einblicke die Wissenschaft ermöglichen Auf internation s Dach- und Fachverband vereint seit dem März regionale und lokale Vereine Institutionen und engagierte Einzelpersonen aus dem Bereich der naturwissenschaftlich-technischen Jugendbildung Aktuelle Themen Workshop Licht SeptemberVon Sonnenfotos bis Lichtmalerei Gemeinsam mit Sabine Schreier vom Medienpotpourri Leipzig tauchen die Teilnehmenden die spannende Welt der Licht-Experimente ein Vormittag heißt Licht an! Hier dreht Diese enormen Bedeutungen für den Menschen die Bedrohung der Ozeane als Lebensraum durch den Menschen und ein nachhaltiger Umgang mit den Ressourcen der Weltmeere bilden die Grundlage vieler Projekte und Veranstaltungen der kommenden Monate International Year Global Understanding Meere und Ozeane Aktuelles Workshop Licht SeptemberAusbildung zum zur Experimentiertrainer inKick off FIRST LEGO League für Schülerlabor DresdenE Landesverband Sächsischer Jugendbildungswerke e import url css screen !window write type text src files addons jqlightboxes min x3E x3C x3E ready rel lightbox swipebox loopAtEnd true VerbandAktuellWir über unsMitgliederMitglied werdenMitgliederlisteMitarbeiter innen und VorstandDokumenteSpende und Science Day for Youth ScienceCamps LEGO FebruarFachtagung Technik und Ethik TeinanderExperimentiertrainer SeptemberKITA-Fachta g Bauen und Konstruieren KITA-Fachtag Licht BeratungInternationalesEXPO SCIENCESInternationaler FachkräfteaustauschEuropäischer FreiwilligendienstFachgespräch Internationale ArbeitEXPO Science Europe ToulouseDeutsch-tunesische JugendbegegnungWettbewerbeFIRST LEGO LeagueWTH WettbewerbSolaris CupSächsischer InformatikwettbewerbScience Photo ContestWettbewerbe von Mitgliedern und PartnernReferenzenEXPLORIS Spaß ForschenDas Wi ssenschaftsmobil WIMOEXPO Science Europe Internationaler Spielmobilkongress der Stadtentwässerung Dresden GmbHInhouse-Schulungen und Jugendhaus INSELWWF ArtenschutzkofferScienceCupEXPO SCIENCE Europe FreiwilligendienstKontakt Landesverband Sächsischer Jugendbildungswerke e HERZLICH WILLKOMMEN BEIM LJBW Der LandesverbandDer Landesverband Sächsischer Jugendbildungswerke e LJBW ist anerkannter Träger der freien Jugendhilfe Al aler Ebene lautet das diesjährige Thema EURGlobal Understanding Hauptziel ist hier die Sensibilisierung für nachhaltige Lebensweisen eine dauerhafte Ressourcennutzung und die Verbesserung der Lebensqualität jedes Einzelnen Das Deutsche Wissenschaftsjahr trägt den Namen EURMeere und Ozeane bedecken der Erdoberfläche bilden die Nahrungsquelle vieler Menschen und beherbergen ein großes Rohstoffvorkommen unter dem Meeresboden owie Freizeiteinrichtungen kann und muss Platz fürs Experimentieren und Probieren sein weiterlesen Kick off FIRST LEGO League neue Saison des weltweiten Roboterwettbewerbes FIRST LEGO League wirft seine Schatten voraus diesem Jahr möchte der LJBW als Regionalpartner für Dresden und Umgebung eine Möglichkeit bieten bewährte und neue Teams mit den Herausforderungen der neuen Saison bekannt machenweiterlesen Mehr aktuelle Art | Der Landesverband S chsischer Jugendbildungswerke e V ist als Dachverband anerkannter Tr ger der freien Jugendhilfe In Sachsen betreibt der LJBW Freizeiteinrichtungen der Kinder und Jugendarbeit | 1. ljbw.de PR-Navi.de
2. PR-Navi.de ljbw.de

h ihren Auffassungen und Erfahrungen Reichtum und Armut und fragen und eine Büroklammer gegen immer EURwertvollereEUR Gegenstände eintauschen Die Aufgaben zeigten uns dass auch dieses Thema nicht nur theoretisch durchgekaut sondern auch praktisch umgesetzt und erfahren werden kann Das Highlight Ende der Seminarwoche waren die Vorstellungen der verschiedenen Langzeitprojekte die Beginn der Woche ausgewählt wurden Vier verschiedene Gruppen hatten sich die ganze Woche lang verschiedenen Themen ein Projekt überlegt und dieses nach ihren Vorstellungen umgesetzt Ende der Woche gab eine Fotostory zum Thema Religion eine Collage zum Thema Vielfalt Texte zum Thema Gender und Rollenbilder und einen Kurzfilm zum Thema Krankheit und Behinderung Alles allem war eine sehr interessante und lehrreiche Woche mit vielen engagierten und offenen TeilnehmerInnen die eine Menge Spaß und Interesse Diskussionen und aktuellen politischen Themen mitbrachten Auch außerhalb der Seminareinheiten und während der EURHallo wachEUR- und Kooperationspiele herrschte immer gute Stimmung und eine freundliche Atmosphäre Kommentare Feb Jugendleiter-innen Card erwerben Kommentare Impressum AGB Widerrufsbelehrung und EUR formular Liefer- und Zahlungsbedingungen Sitemap Anmelden Abmelden Bearbeiten zuklappen Diese Webseite verwendet Cookies werden zur Benutzerführung und Webanalyse verwendet und helfen dabei diese Webseite besser machen Mehr Infos hier Ok e gelb Der Ort war echt ein Augenschmaus Das Häuschen sah wie Villa Kunterbunt aus gab grüne blaue und rote Zimmer bloß die Bilder der Wand waren noch schlimmer gab auch eine komfortable Sofaecke Justin saß dort oft nachts wie eine Zecke wollte halt nicht gehen das konnten wir aber alle verstehen Die Teamer waren nett und hilfsbereit und vor lauter Bescheidenheit Nannten wir Julian fortan EURMagic MikeEUR Wir haben viel gelernt was ist unsere Kompetenz? Oder ein Outdoorspiel wie Schere Stein Papier mit Fans Wir schrieben Briefe uns selbst ohne viel GezickEUR danach draußen ein Koop mit dem Titel EURPanik auf der TitanicEUR Tag und Nacht hat man nachgedacht Wann hatEUR den nächsten dahingerafft Ein mörderisches Spiel und subjektil! harmlose Gegenstände für Täter die erste Wahl Wurden für die Opfer zur todsicheren Qual Wir hatten einen Wahlkampf für unsere Gruppensprecher Marcel erinnere ich mich gern als Häschenlöffelbecher Das bleiben schöne Erinnerungen das BFD und FSJ tja das war gereimt wie ein Gott! Zum Abschied das Einführungsseminar ein Zitat A-Moll Das Seminar fanden wir alle toll Und jetzt mögen wir uns alle voll! Das Zwischenseminar begann mit einem Spiel namens EURGrabbelsackEUR den Gesichtern las man EURWhat the ?EUR Weitere tolle Spiele kamen hinzu Hose Partner und Pferderennen lernten Wir haben uns gesehen und wie Leute uns wahrnehmen daraus verstehen wie wir hier heute stehen Bei den Ritualen war imme r Schulzeit erlebt hatten und erzählten Kleingruppen unseren Mitschülern was wir alles erlebt haben Bevor zum Essen ging befassten wir uns mit unseren Kompetenzen und wie sie sich über die Schuljahre entwickelt hatten mehr lesen Kommentare Aug A-Blau Das letzte mal EURblauEUR ist jetzt wohl soweit die Abschlussseminarzeit Man lernt sich wieder kennen doch wird man sich auch trennen Die Frage Und wie war das Jahr? war klar ganz wunderbar! Mit höhen und Tiefen alles dabei mal gut mal schlecht mal viel Geschrei Das wichtigste aber bleibt die Veränderung der Zeit Man wächst nämlich nicht nur durch Nahrung sondern vor allem durch Erfahrung Doch nun genug der Reflexion als nächstes kommt die Korruption Und zwar Sport wie jeder weiß das Betrügen hat auch seinen Preis ist traurig der Welt regieren scheint das Geld sollte nicht sein denn glücklich reich das ist nur Schein Der einzig wahre Wert und Sinn der steckt jedem Menschen drin Hört sich schon wie ein Philosoph ich hoffe das klingt jetzt nicht doof Das Sportliche das darf nie fehlen also gehen wir Swingolf spielen Weit ausgeholt doch oft verzogen nur manchmal dann hohen Bogen fliegt der Ball sodann zum Loch mega nice was fehlt noch? Swingolf war ein riesen Spaß nur Ende etwas nass der Runde dann oft diskutiert und Vorstellung der Projektpräsentation Das Essen war natürlich nett möglichst gesund und nicht fett und selbst gekocht welch ein Gedicht man sieht jedem Gesicht n -30 Das wohl politischste Vertiefungsseminar fand vom bis zum Brodten bei Travemünde statt Der Titel EURToleranz und VielfaltEUR lockte mit seiner Aktualität und versprach eine interessante und breit gefächerte Themenauswahl Die Seminareinheiten der sechs Tage wurden mit präsenten Themen gefüllt denen alle TeilnehmerInnen ihre Meinung hatten Toleranzgrenzen Flucht Reichtum und Armut sowie Doing Gender und Undoing Gender Die Inhalte wurden von den TeilnehmerInnen erarbeitet diskutiert und durch praktische Projekte erfahren und gefestigt Eine Aufgabe die besonders zum Denken anregte wurde uns zum Thema Flucht gestellt Minuten sollten wir eine Plastiktüte mit allen Gegenständen packen die wir mit auf eine Flucht nehmen würden Mehr Zeit bleibt auch vielen Kriegsgebieten nicht Zusätzlich blieb viel Platz für die kreative Umsetzung von Plakaten und eigenen kleinen Projekten wie zum Beispiel die Gestaltung einer Kampagne zum Thema Undoing Gender und dem Aufbrechen von Rollenbildern Auch der Meinungsaustausch kam nicht kurz vielen Diskussionsrunden oder Kleingruppenarbeiten wurden Perspektivenwechsel vorgenommen und sowohl aus anderen Blickwinkeln als auch aus dem eigenen argumentiert Bei einem Nachmittagsausflug das nahgelegene Lübeck hatten wir die Chance die Stadt durch eine Rätsel- Rallye kennen lernen Gleichzeitig mussten kleine Aufgaben erfüllt werden Wir sollten Menschen eine nicht-materielle Freude machen sie nac es haben wir morgens Kleingruppen ein Gruppenphasenmodell erarbeitet und uns gegenseitig präsentiert Danach haben wir das Kooperationsspiel EURBrückenbauEUR gespielt Dabei gab leider Streitigkeiten die sich aber Laufe des Tages durch Einsatz der Teamer und der Gruppe selbst wieder gelegt haben Nach dem Mittagessen haben wir EURFlugzeugsabsturzEUR gespielt Das hat uns alles sehr gefallen Dann beschäftigten wir uns den Rest des Tages mit dem Thema Spielpädagogik Die Aufgabe bestand darin ein eigenes Kooperationsspiel für die Gruppe gestalten Auch wenn sich etwas die Länge gezogen hat großen Spaß gemacht Nach dem Abendessen haben wir uns Uhr getroffen ein letztes Mal den Abend ausklingen lassen Der Abschlussabend verlief nicht ganz wie geplant doch trotz all dem war witzig! Wir bedanken uns bei den Teamern für die schönen Tage Kommentare Mär Erste-Hilfe und mehr Meldet euch an! Erste Hilfe Druck neu pdf Adobe Acrobat Dokument Download Kommentare Mär Last but not Least E-Türkis Montag der wohl spannendste Tag unserer Woche Die meisten waren sich diesem Zeitpunkt noch total fremd Doch kaum glauben nur ein paar Stunden später saß die Gruppe lachende und mit reichlich Spaß zusammen Tja daran kann man mal sehen was eine kurze Borstellungsrunde und paar Stunden ausmachen können Dienstagmorgen beim Frühstück war die Müdigkeit jedem von uns ins Gesicht geschrieben Doch ist das nun mal unserem ersten Seminartag beschäftigten w ir uns mit mehreren Themen wie Nähe Distanz und Rechte Pflichten Gerade ersteres war für alle recht interessant Dieses Thema wurde spielerisch behandelt was echt Spaß gemacht hat Mittwoch ging dann darum unsere versteckten Fähigkeiten finden Wir fanden durch einen Tiertypentest unsere Eigenschaften raus und teilten sie gemeinsam Aber mein persönliches Highlight dem Tag war der Brief uns selber Einen Brief unser EURZukunfts-IchEUR schreiben war sehr komisch und war eine tolle Erfahrung Dann war auch schon der letzte Tag Donnerstag beschäftigten wir uns mit der Wahl zum Sprecher der ein paarmal einer Sitzung nach Kiel fährt Nach dem Mittagessen fuhren wir alle nach Lübeck und machten eine EURLächelsafariEUR wir Bilder bestimmten Themen mit einem Lächeln machen sollten Das war total cool Abend saßen wir gemütlich zusammen spielten Spiele lachten und genossen den letzten Abend Damit war unsere Seminarwoche auch fast rum Fazit aus der Woche Wir alle haben neue nette und liebe Menschen kennengelernt Wir sind Freunde geworden Wir danken den Teamern Eli Daniel und Henning sehr für diese paar unvergesslichen spaßigen und interessanten Tage! Liebe Grüße E-Türkis Kommentare Mär Bring dich Aktion! mehr lesen Kommentare Feb Terminübersicht GERECHTE GESELLSCHAFT Terminübersicht Gerechte Gesellschaft Ort Landesgeschäftstelle des LJW der AWO S-H Sibeliusweg Kiel - Raum Kommentare Feb Vertiefungsseminar Toleranz und Vielfalt Brodte Zusammen macht uns alles Freude auch wenn wir sind wilde Meute wird später sicher noch oft dran gedacht was wir alles zusammen gemacht spielen lernen reden lachen und noch all die anderen Sachen Abschied hat niemand sehr gern denn danach ist man fern wird man auseinander gehn und sich vielleicht nie wieder sehn Doch nicht viele Trauergedanken wir wollen uns hier jetzt noch bedanken Bei den Teamern ist doch klar und zwar für das ganze Jahr Ganz besonders für die Jule sie ist mega coole! Sie halfen uns all der Zeit und machten uns auch bereit für die Zukunft EURBleibt BallEUR Alles Gute überall! Kommentare Jul Sommer Öffnungszeiten Kommentare Jun Natur pur per Kanu2016 pdf Adobe Acrobat Dokument Download Kommentare Mai Föhr - Meldet euch an! Kommentare Mai V10 Kreativ Diese Woche wurde sehr kreativ der Villa Kunterbunt wie wir sie nennen Diese Villa lädt förmlich zum kreativ werden ein Wir haben dieser Woche viele kleine Workshops gemacht Wie auf dem Bild sehen eine kleine Auswahl von Malen und Zeichnen Ugly Dolls aus Stoffresten Gips und Upcycling Daneben haben wir noch viel mehr gelernt Kunst hat viele Gesichter Die Kreativität sich sehen ist eine Kunst wer aus ihr schöpft ist ein Künstler Wilma Eudenbach harmonierte alles miteinander Die Teamer wir und die Lacation arbeiteten gemeinsam einer kreativen Neufindung Kommentare Mai A-gelb - Ein Rückblick Irgendwo Schülp auf einem Feld Traf ich zum Mal auf Seminargrupp r Vordergrund der Tanz auch ein Koop mit dem Titel EURBlinder RiesenschwanzEUR lustigsten war der Abschlussabend Wir spielten Spiele tanzten völlig ungeniert Plötzlich ist etwas passiert Justin versuchte einen Handstand gegen die Wand und flog Wir hielten darüber einen langen Dialog Danach bekam Marcel sich nicht mehr ein Und lachte noch Stunden mutterseelenallein Wir haben lange darauf gewartet Und unsere letzte Woche ist gemeinsam gestartet Wir geben nochmal alle richtig Gas und haben diese Zeit sehr viel Spaß! Kommentare Mai Zwischenseminar Pink Abenteuer Brodtwarts Unser zweites Schuljahr der Zauberschule begann mit der Anreise Brodtenexpress nach Brodtwarts Dort angekommen wurden wir wieder unsere Zimmer und Häuser Nach einer kurzen Pause versammelten wir uns alle Klassenzimmer jeder einmal unter den Unsichtbarkeitsmantel durfte sein unsichtbares-Ich vorzustellen wir uns lange nicht gesehen hatten und uns noch ein bisschen besser kennen lernen erstellten wir einen Steckbrief für einen unserer Mitschüler welche wir später vor dem Klassenzimmer aufgehängt wurden Sobald jeder wieder auf seinem Platz saß und einen Mitschüler vor sich sitzen hatte stellte sich uns die Talkbox vor welche uns verschiedene Fragen über uns stellte welche wir abwechselnd beantwortet haben wir Schüler uns diesem Schuljahr auch wieder selbst einbringen sollten ließen uns die Professoren alleine damit wir ein paar Aufgaben unter uns auftei Startseite - Landesjugendwerk der AWO S-H html body hidden display none padding emotion-header position relative emotion-header-logo emotion-header-title position absolute window use strict regBuff window regModuleBuffer args slice call arguments regBuff push args !window regModule window regModule regModuleBuffer window Aug A-Pink sagt Tsssschüß Das letzte Schuljahr Nach einer kurzen Pause ging für uns weiter ins letzte Jahr Doch dieses Mal ging nicht nach Brodtwarts sondern nach Nindorf die dortige Zauberschule Wir freuten uns über das Wiedersehen und wir wollten noch gar nicht das Ende des Jahres denken Wie immer begann der erste Tag damit dass wir unsere Zimmer zogen bevor mit dem Unterricht begann auch diesem Jahr wieder einige neue Gesichter uns stießen gab wie immer eine kleine Kennenlernrunde Danach wurden die Aufgaben für die Woche verteilt und wir redeten mir unseren Mitschülern über unsere Tätigkeiten zwischen den Jahren Zum Abschluss des ersten Unterrichtstages tanzten wir eine Runde und gingen zum Abendessen Nach dem Essen saßen wir kleinen Gruppen den Zimmern oder Gemeinschaftsraum beisammen tranken Butterbier und zauberten einige Werwölfe herbei Nach einer teilweise unruhigen Nacht begann der zweite Tag Vormittag stellten uns einige Mitschüler ihre magischen Projekte die sie über die Schulzeit entwickelt und durchgeführt hatten vor Nach einer kleinen Pause erarbeiteten wir Einzelarbeit was wir unsere len konnten Dies lief leider nicht ohne Probleme doch nach einiger Zeit hatten wir für alle Aufgaben Verantwortliche gefunden und wir gingen alle gemeinsam die große Halle zum Abendessen mehr lesen Kommentare Apr Zwischentreffen türkis Als Donnerstag das Zwischenseminar begonnen hat haben sich alle sehr gefreut sich wieder sehen Das merkte direkt bei der Ankunft als alle sich vor Freude umarmten ersten Seminartag haben wir uns erst nochmal kennengelernt und auch ein neues Gesicht war dabei Abend haben wir uns zusammen eine Feuershow angesehen Auch wenn das Wetter leider nicht ganz mitgespielt hat war das ein netter Einstieg zweiten Tag gab eine kurze Einführung das Thema Sucht Danach haben wir uns auf den Weg nach Lübeck die Suchtberatungsstelle der AWO gemacht Dort haben wir uns einen spannenden Vortrag zum Thema Drogen und Suchtverhalten angehört Wir alle fanden das ziemlich interessant Danach haben wir uns mit dem Tankmodel beschäftigt was auch ziemlich aufschlussreich war Die Mittagspause haben wir Lübeck verbracht Als wir wieder der Tagesstätte angekommen sind ging mit dem Thema EURpsychische ErkrankungenEUR weiter Zum Einstieg haben wir einen Film über Autismus geschaut war spannend erklärt bekommen wie Autisten die Welt anders wahrnehmen Zusätzlich haben wir uns mit Depressionen und Demenz genauer informiert Den Abend haben wir beim Werwolf spielen ausklingen lassen dritten und leider letzten Tag des Seminar | sex
| ljw-awo-sh.de |


Sex xXx fick Erotik sexy hardcore
1. ljw-awo-sh.de PR-Navi.de
2. ljw-awo-sh.de PR-Navi.de

sex | Diese |
ljmodels.de | endin isResolved isDeferredComplete deferreds for push select push stack index stack isDeferredPendin deferreds length for isDeferredComplete deferreds length deferreds isDeferredPendin typeof b?b toStrin replace ngm replace gm replace i j block p isResolved und isDeferredPendin hasOwnProperty key No key specified WARN key typep type k resolve value ? isPendin i p isPendin und render i und isResolved o und render switch und toLowerCase case number case Strin case boolean und Boolean case date new Date tap resolve sep block stack index stack of-1? d?d first stack index? block last stack index stack of-1? block contextDump i resolve to resolve key switch case full stack break default stack head switch JSON stringify i case console contextDump break default replace lte gt gt gte any g? isDeferredComplete?b any Must not nested inside any none block ERROR map deferreds push isResolved und render block end any Must used inside select block ERROR none g? isDeferredComplete?b none Must not nested inside any none block ERROR map deferreds push isResolved render block end none Must used inside select block ERROR size key resolve key und h! isArray length !isNaN parseFloat und isFinite else object typeof for hasOwnProperty und else length write for helpers w register ads 1tier dustBody dust w get SPONSORED LINKS s get ads block w w get line1 w get line2 get line3 w get visible url w register ads 2tier dustBody dust w eq block key get buyboxTopi value true type boolean w get block w w get w register webarchive bootstrap dustBody dust w get POPULAR CATEGORIES s get webArchive block w w ? get pus s und category get w und keyword get w get block w w get w register webarchive stati dustBody dust dto ct mappin dto ct mappin oneclick dto ct mappin webarchive dto ct mappin webarchive dto ct mappin twoclick dto ct mappin oneclick dto ct mappin webarchive dto ct mappin twoclick domIsReady attachEvent undefined typeof attachEvent? ie not-ie und typeof und ie ? addEventListener DOMContentLoaded attachEvent onreadystatechange complete readyState domIsReady switch body dto advt case push onet break case push twot undefined typeof dto contentType und push dto ct mappin dto contentType undefined typeof dto und push dto length 1? addClass join addClass window domIsReady dust helpers columnSplit Math ceil lengthd columns index und f! length dust helpers showRelatedLinks 0! Object keys stack head rls length loadRls url dto rlUrl und num method GET dataType dto rlRequestMode success void und void length contentSecondTierDat rls dto advt und dto contentType und 3! dto contentType und appendCafRls complete renderContentBlock appendCafRls contentSecondTierDat rls length isplay none input button solid paddin input margin-right button font-weight bold cursor padding-left padding-right content-disclaimer font-size content-disclaimer sedologo float left content-disclaimer link content-disclaimer visited text-decoration underline content-disclaimer active content-disclaimer focus content-disclaimer hover text-decoration none content-imprint clear both content-imprint link content-imprint visited display block text-align center paddin text-decoration underline content-imprint hover content-imprint active content-imprint focus text-decoration none content-privacy-policy privacy-policy-text display none solid paddin margin-top content-privacy-policy privacy-policy-link clear both content-webarchive zoom paddin content-webarchive before content-webarchive after content display table content-webarchive after clear both content-webarchive font-size font-weight bold content-webarchive div webarchive-block float left margin-right margin-bottom content-webarchive div webarchive-block font-weight bold content-webarchive div webarchive-block link content-webarchive div webarchive-block visited text-decoration none content-webarchive div webarchive-block active content-webarchive div webarchive-block focus content-webarchive div webarchive-block hover text-decoration underline content-webarchive div webarchive-block none inside content-webarchive div webarchive-block margin-top padding-top container-content -webkit-box-shadow box-shadow content-relatedlinks -webkit-box-shadow box-shadow container-footer color eee container-footer color eee domain color container-relatedlinks span color container-relatedlinks link container-relatedlinks visited color container-relatedlinks hover container-relatedlinks active container-relatedlinks focus color E57921 container-relatedlinks color C1C1C1 container-relatedlinks link container-relatedlinks visited color container-relatedlinks hover container-relatedlinks active container-relatedlinks focus color E57921 content-ads color content-ads link content-ads visited color content-ads hover content-ads active content-ads focus color E57921 content-ads color C1C1C1 content-ads link content-ads visited color content-ads hover content-ads active content-ads focus color E57921 input B2B2B2 button none repeat transparent color C9EC6 B2B2B2 content-webarchive color content-webarchive div webarchive-block link content-webarchive div webarchive-block visited color content-webarchive div webarchive-block active content-webarchive div webarchive-block focus content-webarchive div webarchive-block hover color E57921 text-decoration none content-webarchive div webarchive-block link content-webarch sn undefined typeof und push error code undefined typeof und push und parseInt error code undefined typeof und length und url join undefined typeof alternatePubId und error code und -1! inArray parseInt error code pubId alternatePubId onclick param onclick value length und createCaf apply this und resultsPageBaseUrl caf? pus und las sedoparkin php? param each cafEl inArray tlt this met layoutTypes ads this caf type und this caf number this caf type und prs this caf type und dsb push this caf pdto caf noAds delete pdto caf noAds resultsPageBaseUrl caf? pus onclick param onclick value onclick param onclick value pageLoadedCallback undefined typeof window createCaf ads domains Caf apply this prototype ads domains Caf prototype new arguments length und createCaf apply this typeof define und define amd?define object typeof exports?module exports Polyglot this use strict this phrases this extend phrases this currentLocale locale this allowMissin this warn warni for hasOwnProperty for replace null! und a? split for und hasOwnProperty und replace new console und console warn und console warn WARNIN for VERSION prototype locale und this currentLocale prototype extend for hasOwnProperty und object typeof c?this extend this phrases prototype clear this phrases prototype replace this clear this extend prototype null b? number typeof und smart count strin typeof this phrases ? this phrases strin typeof ? this allowMissing? this warn Missin translation for key strin typeof und this currentLocale smart count prototype has in this phrases chinese german a?1 french 1?1 russian 10 und 100! 11?0 und dust NONE undefined typeof process und process env und bdust test process env DEBU und dust DEBU dust helpers dust cache dust register und templateName dust confi cache! und dust cache dust render new Stub head try load end catch setError dust stream new Stream head dust nextTick try load end catch setError dust loadSource source eval source dust isArray Array isArray?Array isArray object Array Object prototype toStrin call dust nextTick setTimeout dust isEmpty und !dust isArray length dust isEmptyObject null return!1 void return!1 length return!1 for Object prototype hasOwnProperty call return!1 return!0 dust isTemplateFn typeof und dustBody dust isThenable und object typeof und typeof then dust isStreamable und typeof on und typeof pipe dust filter for length und dust filters g?b null typeof h? dust lo Invalid filter WARN und dust filters dust escapeHtml dust u encodeURI encodeURIComponent dust jp JSON?JSON parse dust lo JSON undefined could not parse WARN dust makeBase dust context new Context void Context wrap instanceof Context? new Context null Context p wait null dust isStreamable ?this stream null dust isEmpty ?this write dust filter Chunk prototype section block else this typeof und !dust isTemplateFn try apply current this catch dust lo k ERROR this setError instanceof Chunk dust isEmptyObject push dust isArray length for stack und stack head len idx push idx void len void i i this else dust isThenable this await dust isStreamable this stream this else a0 this push else i i this dust lo Section without correspondin key template getTemplateName DEBU this Chunk prototype exists block else dust isEmpty this else this dust lo No block for exists template getTemplateName DEBU this Chunk prototype notexists block else dust isEmpty this dust lo No block for not-exists template getTemplateName DEBU else this Chunk prototype block d?d this Chunk prototype partial void und dust isEmptyObject clone pop push dust isTemplateFn ?this capture templateName load end templateName load this Chunk prototype helper this filters void und !dust helpers dust lo Helper does not exist WARN try dust helpers instanceof Chunk?f strin typeof und split dust isEmptyObject ? reference section catch dust lo Error helper i message ERROR setError Chunk prototype await this map then c?f section reference end und error d?f render push end dust lo Unhandled promise rejection getTemplateName INFO end Chunk prototype stream und block und error this map !1 on dat i f?h map render push end reference error i g?h render push dust lo Unhandled stream error getTemplateName INFO i end Chunk prototype capture this map new Stub a?d setError head end Chunk prototype setError this error this root flush this for Chunk prototype dust aliases und Chunk prototype dust aliases Chunk prototype Tap prototype push new Tap this Tap prototype for this head tail HCHARS und AMP und QUOT SQUOT dust escapeHtml strin typeof und typeof toString? strin typeof und toStrin HCHARS test ? replace AMP und replace QUOT replace SQUOT und BS FS LS u2028 PS u2029 NL LF SQ DQ TB dust strin typeof a? replace r replace u2028 replace u2029 replace dust JSON?JSON stringify replace u2028 replace u2029 replace u003 dust lo JSON undefined could not escape WARN dust typeof define und define amd und define amd dust und define require dust core onLoad typeof define und define amd und define amd dust !0?define dust core object typeof exports?module exports require dust this INFO b? lo Deprecation warnin is deprecated and will removed future version dustjs-helpers WARN null For help and deprecation timeline see github replace WARN stack tail und stack tail head undefined typeof stack tail head select und get select stack head rebase stack und stack tail und stack tail isP RELATEDLINKS TOPI Weitere Links Suche SPONSORED LINKS Sponsored listings TITLE Informationen zum Them keywordStrin TITLE TOSELL Diese Website steht zum Verkauf! TOSELL TEASER Die Domain wird vom Inhaber zum Verkauf angeboten TOPI Suche WELCOME CATEGORY domainName ist Ihre erste und beste Informationsquelle u00fcber keywordStrin Hier finden Sie auch weitere interessante Links Wir hoffen dass Sie bei Ihrer Suche erfolgreich sind! WELCOME NOCATEGORY domainName ist die beste Quelle u00fcr alle Informationen die Sie suchen Von allgemeinen Themen bis hin speziellen Sachverhalten finden Sie auf domainName alles Wir hoffen dass Sie hier das Gesuchte finden! cafEl met layoutTypes caf container nessie type ads lines blank true verticalSpacin afs comdp-sedobullet lime gif colorTitleLink colorText C1C1C1 colorDomainLink C9EC6 titleBold true rolloverLinkColor E57921 rolloverLinkUnderline true met layoutTypes caf container elliot type number true colorTitleLink C9EC6 rolloverLinkColor E57921 rolloverLinkUnderline true met layoutTypes caf container stitch type number columns true colorTitleLink rolloverLinkColor E57921 rolloverLinkUnderline true titleBold true afs comdp-sedobullet lime gif met layoutTypes caf container sb-toothless type true C9EC6 dto und url dto php? dto tscQs ContainerNotFoundException this container this message ContainerNotFoundException raised this container insert dust render try null throw new ContainerNotFoundException catch dto append try null throw new ContainerNotFoundException parentNode div void und dust render appendChild catch dto lazyload type asyn item length-1 insertAfter undefined typeof und onclick param dto signedLink onclick value dto gFeedSES default onclick value dto gFeedSES alternate onclick param dto visitorViewId onclick value dto postActionParameter feedback undefined typeof dto postActionParameter token und dto postActionParameter token undefined typeof dto postActionParameter token und csb dto postActionParameter token undefined typeof dto postActionParameter token und csn dto postActionParameter token dto postActionParameter token logErrorCode dto postActionParameter token logErrorCode dto postActionParameter token artificialBid dto postActionParameter token artificialBid dto pus tlt dto contentType prs dto rlStrategy dsb dto alternatePubId pdto caf transparent dto jsParameter und alternatePubId dto jsParameter alternate pubid requestParams dto jsParameter request each requestParams pdto caf requestParams adult und true adult und adult! !0ds! und adult und adult! !1ds! push und adult und client faillisted und push csb needsreview und needsreview error code und -1! inArray parseInt error code und push c visible url qualigo com de advertiser information url thumb cost usd2 cost2 revenue2 usd link parameters pos complete url www ljmodels de redirect php?f qualigo de query php de und revenue cost usd advertiser type line1 kultmodell de u00fcr EUR kaufen line2 line3 u00f6chten Sie die Domain kultmodell de jetzt sofort u00fcr EUR erwerben? Kaufen Sie die Domain zum Festpreis oder nennen Sie uns unter Ihren Preisvorschla url qualigo de query php de visible url kultmodell de url thumb cost usd2 cost2 revenue2 usd link parameters pos complete url www ljmodels de redirect php?f qualigo de query php de und revenue cost usd advertiser type line1 Kalender Famous British Square nur EUR line2 line3 Kaufen Sie den Artikel Famous British Square British model cars shown different sceni layouts Monthly calendar pages von Huschk Klaus-Peter als Kalender schnell und unkompliziert u00fcr nur EUR bei averdo Portofrei Schnelle Lieferun Monat Widerrufsrecht u00e4uferschutz durch PayPal Keine Anmeldun u00f6ti url qualigo de query php de visible url buecher-druckwaren averdo de url thumb cost usd2 cost2 revenue2 usd link parameters pos complete url www ljmodels de redirect php?f qualigo de query php de und revenue cost usd advertiser type line1 Kalender VW-K u00e4fer Modell quer nur EUR line2 line3 Kaufen Sie den Artikel VW-K u00e4fer Modell quer u00e4fervielfalt Bild Monatskalender Seiten von Huschk Klaus-Peter als Kalender schnell und unkompliziert u00fcr nur EUR bei averdo Schnelle Lieferun Monat Widerrufsrecht u00e4uferschutz durch PayPal Keine Anmeldun u00f6ti url qualigo de query php de visible url buecher-druckwaren averdo de url thumb cost usd2 cost2 revenue2 usd link parameters pos complete url www ljmodels de redirect php?f qualigo de query php de und revenue cost usd advertiser type line1 Kalender Die kleinen Leute aus quer nur EUR line2 line3 Kaufen Sie den Artikel Die kleinen Leute aus quer u00f6ln aus der Perspektive einer Modells Monatskalender Seiten von Claushallmann Michael als Kalender schnell und unkompliziert u00fcr nur EUR bei averdo Portofrei Schnelle Lieferun Monat Widerrufsrecht u00e4uferschutz durch PayPal Keine Anmeldun u00f6ti url qualigo de query php de visible url buecher-druckwaren averdo de url thumb cost usd2 cost2 revenue2 usd link parameters pos complete url www ljmodels de redirect php?f qualigo de query php de und adv advt rlRequestMode jsonp rlbox rlUrl sedoparkin com php?rlt waUrl portal php?l true tscQs und ses und MTk3ODA5NzEz und OTIuMjI3LjQ5LjE5N und bf5e6d555e85b6672b61e57a1e895e54019b4013 und rlSes ses lan de maid sedoParkingUrl www sedo com parkin php3?language und partnerid signedLink visitorViewId i18n BUYBOX BROK ERAGE Diese Domain u00f6nnte zum Verkauf stehen! BUYBOX FULL Diese Domain ist verkaufen BUYBOX INQUIRE Anfragen BUYBOX TEASER NOPRICE Sie u00f6nnen die Domain domainName kaufen! BUYBOX TEASER PRICE Sie u00f6nnen die Domain domainName u00fcr domainPrice domainCurrency vom Inhaber kaufen BUYBOX TOPI Domain erwerben FOOTER DISCLAIMER Die auf dieser Seite bereitgestellten Listings kommen von dritter Seite und stehen mit Domain-Inhaber oder Sedo keiner Beziehun Bei markenrechtlichen Problemf u00e4llen wenden Sie sich bitte direkt den Domain-Inhaber Whois Deni de FOOTER DOMAIN APPRAISAL Domain-Bewertun FOOTER DOMAIN AUCTION Domain-Auktion FOOTER DOMAIN BUY Domain suchen FOOTER DOMAIN ESCROW Domain-Umzu FOOTER DOMAIN MAIN Domainnamen FOOTER DOMAIN PARKIN Domain-Parkin FOOTER DOMAIN Domains verkaufen FOOTER DOMAIN SELL Domain anbieten FOOTER DOMAIN TOP Top-Domains FOOTER REGISTRAR INFO Sind Sie der Domain-Eigent u00fcmer und u00f6chten wissen wieso diese Domain anders als die anderen geparkten Domains aussieht? FOOTER REGISTRAR INFO LINK Infos hier FOOTER REGISTRAR INFO TEASER Diese Domain ist entweder nicht korrekt auf die Sedo-Domain-Parkin URL weitergeleitet oder noch nicht die Sedo-Datenbank worden Bitte u00fcberpr u00fcfen Sie die Weiterleitun und tragen Sie diese Domain erst Ihrem Kundenmen u00f ein! FOOTER TEASER Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm LANGUAGE Sprache POPULAR CATEGORIES Beliebte Kategorien Privacy Policy TXT usin our site you consent this privacy policy This website allows third-party advertisin companies for the purpose reportin website traffi statistics advertisements click-throughs and other activities use Cookies and Web Beacons and other monitorin technologies serve ads and compile anonymous statistics about you when you visit this website Cookies are small text files stored your local internet browser cache Web Beacon often-transparent graphi image usually larger than pixel that placed Web site Both are created for the main purpose helpin your browser process the special features websites that use Cookies Web Beacons The gathered information about your visits this and other websites are used these third party companies order provide advertisements about goods and interest you The information not include any personal dat like your name address email address telephone number you would like more information about this practice and know your choices about not havin this information used these companies click here REGISTRAR FAQ CLICKTEXT Infos hier REGISTRAR FAQ TEXT Sie sind der Domain-Eigent u00fcmer und u00f6chten wissen wieso diese Domain anders als die anderen geparkten Domains aussieht? ljmodels de und nbspDiese Website steht zum Verkauf! und nbspInformationen zum Them ljmodels text-center text-align center left container-left float left right container-right float right container-buybox empty container-domainName empty container-content empty container-disclaimer empty container-webarchive empty container-imprint empty container-privacyPolicy empty left empty right empty container-relatedlinks empty content-relatedlinks empty container-ads empty display none normalize css MIT License git ionormalize article aside details figcaption figure footer header hgroup main nav section summary display block audio canvas video display inline-block display inline zoom audio not controls display none hidden display none html font-size -ms-text-size-adjust -webkit-text-size-adjust html button input select textare font-family sans-serif body focus outline thin dotted active hover outline font-size abbr title dotted stron font-weight bold blockquote dfn itali -moz-box-sizin content-box -webkit-box-sizin content-box box-sizin content-box mark FFFF00 color pre code kbd pre samp font-family monospace serif font-family courier new monospace font-size pre white-space pre-wrap word-wrap break-word quotes none before after content none small font-size sub sup font-size position relative vertical-align baseline sup top sub bottom menu none nav none -ms-interpolation-mode bicubi not root overflow hidden figure form fieldset none paddin legend white-space normal margin-left -7px button input select textare font-size vertical-align middle button input normal button select text-transform none button html input type button input type reset input type submit -webkit-appearance button cursor overflow visible button disabled html input disabled cursor default input type radio -webkit-box-sizin -moz-box-sizin box-sizin input type -webkit-appearance textfield -moz-box-sizin content-box -webkit-box-sizin content-box box-sizin content-box input type -webkit-appearance none button -moz-focus-inner input -moz-focus-inner textare overflow auto vertical-align top table collapse fieldset margin right vertical margin menu dir -moz-padding-start dose12 position absolute top -500px buybox-content margin paddin solid -webkit-box-shadow box-shadow word-wrap break-word float right buybox-content font-size !important color fff buybox-content link buybox-content active buybox-content visited text-decoration none buybox-content hover text-decoration underline buybox-content text-align center display block text-transform uppercase buybox-content font-weight bold buybox-content font-size text-align center margin-top buybox-content font-weight normal float right label d rototype get strin typeof und substr split this get Context prototype get this stack length und head und head?h head void else for und isObject head void tail void c? this global und this global for und i dust isThenable then getWithResolvedDat this slice i typeof h? try apply arguments catch throw dust lo ERROR dustBody !!h dustBody void und dust lo Cannot find reference join template this getTemplateName INFO Context prototype getPath this get Context prototype push void a? dust lo Not pushin undefined variable onto the context INFO this rebase new Stack this stack Context prototype pop this current this stack und this stack tail Context prototype rebase new Context this global this options this blocks this getTemplateName Context prototype clone this rebase stack this stack Context prototype current this stack und this stack head Context prototype getBlock typeof und new Chunk this dat join this blocks dust lo No blocks for context template this getTemplateName DEBU for length c-- dust lo Malformed template this getTemplateName was missin one more blocks Context prototype shiftBlocks this blocks a? c? concat new Context this stack this global this options this getTemplateName this Context prototype resolve typeof a? new Chunk render this instanceof Chunk?b dat join Context prototype getTemplateName this templateName Stub prototype flush for this head flushable error? this callback error dust lo Renderin failed with ERROR void this flush EMPTY FUN void this out dat join next this head this callback null this out Stream prototype flush for this head flushable error? this emit ERROR this emit end dust lo Streamin failed with ERROR void this flush EMPTY FUN void this emit dat join next this head this emit end Stream prototype emit this length dust lo Stream broadcastin but listeners for DEBU for slice length return!0 Stream prototype this typeof b?dust lo No callback provided for event WARN push this Stream prototype pipe typeof write typeof end dust lo Incompatible stream passed pipe WARN this typeof emit und emit pipe this typeof on und on error this dat try write utf8 catch dust lo ERROR end try end catch dust lo ERROR Chunk prototype write this taps und this dat push this Chunk prototype end und this write this flushable this root flush this Chunk prototype map new Chunk this root this next this taps new Chunk this root this taps this next this flushable try catch dust lo ERROR setError Chunk prototype tap this taps b?b push new Tap this Chunk prototype untap this taps tail this Chunk prototype render this Chunk prototype reference typeof a? apply current this null auto filters instanceof Chunk? this reference dust isThenable ?this a ive div webarchive-block visited color content-webarchive div webarchive-block hover content-webarchive div webarchive-block active content-webarchive div webarchive-block focus color E57921 body font-size font-family Arial Helvetic Verdan Lucid Grande sans-serif container-header container-content container-ads overflow hidden container-content margin-bottom solid container-footer paddin container-footer font-size container-ads paddin oneclick content-relatedlinks margin paddin solid margin paddin -webkit-box-shadow box-shadow float left twoclick content-relatedlinks margin paddin solid paddin margin auto container-domainName domain font-size font-weight bold text-decoration none text-transform lowercase word-wrap break-word oneclick content-relatedlinks paddin font-size oneclick content-relatedlinks link oneclick content-relatedlinks visited text-decoration none oneclick content-relatedlinks hover oneclick content-relatedlinks active oneclick content-relatedlinks focus text-decoration underline twoclick content-relatedlinks zoom twoclick content-relatedlinks before twoclick content-relatedlinks after content display table twoclick content-relatedlinks after clear both twoclick content-relatedlinks padding-bottom twoclick content-relatedlinks span twoclick content-relatedlinks left float left twoclick content-relatedlinks right float right twoclick content-relatedlinks paddin twoclick content-relatedlinks font-weight bold font-size twoclick content-relatedlinks before content url sedoparkin comtemplatesbrick gfx1006bullet lime gif float left paddin twoclick content-relatedlinks link twoclick content-relatedlinks visited text-decoration none twoclick content-relatedlinks hover twoclick content-relatedlinks active twoclick content-relatedlinks focus text-decoration underline content-ads before content url sedoparkin comtemplatesbrick gfx1006bullet lime gif float left paddin content-ads div padding-left content-ads div font-size text-transform uppercase font-weight bold content-ads div font-size content-ads div font-size dto domainName ljmodels de domainPrice domainCurrency www ljmodels de dnsh true dpsh toSell true tid oneclick buybox true buyboxTopi true disclaimer true imprint true noFollow toSellUrl www sedo de details ?partnerid und language und cid und lid und domain ljmodels de und sub und origin parkin www ljmodels de parkin php ses gts toSellText imprintUrl rlStrategy contentType content pus ses postActionParameter gFeedSES default alternate jsParameter ads revenue cost usd advertiser type line1 u00f6chten Sie hier werben? line2 line3 Buchen Sie jetzt preiswert bei QualiGO Ihre Werbun zum Them Ljmodels url qualigo de query php de
Sex xXx fick Erotik sexy hardcore
|
1. ljmodels.de PR-Navi.de
2. PR-Navi.de ljmodels.de

Sex xXx fick Erotik sexy hardcore
Bildung Schulen Unterricht Uni Weiteres Wissenschaft Land Forst Agrar Forschungseinrichtungen Projekte Organisationen Persönliche Seiten Umwelt Natur Naturschutz Haus Heim Garten Nach Raum Ort Büro Arbeitsplatz Diele Flur Garderobe Musik Musikszene Fan Versicherungen Rente Vorsorge Leben Tier | Der Landesjagdverband Sachsen Anhalt ist Dachverband f r 39 J gerschaften mit insgesamt 8600 Mitgliedern Auf unseren Seiten finden Sie aktuelle Informationen zur Jagd Pressemeldungen Service und Termine | | LJV-Sachsen-Anhalt Home HomePresseImpressumDatenschutzerklärungfacebook Home Neuigkeiten Verband Neuigkeiten Termine Mitglied werden Organisation Präsidium Geschäftsstelle Obleute Infos für Vorstände Umweltbildung Lernort Natur Jäger Jungjäger Jagdschulen Hundeführer Jagdhornbläser Schützen Falkner Wildbretvermarktung Wildhygiene Recht Versicherungen Rabatte Downloads Shop Wildwarnreflektoren Wild und Naturschutz sen-Anhalt ist Dachverband für Jägerschaften mit insgesamt Mitgliedern Auf unseren Seiten finden Sie aktuelle Informationen zur Jagd Pressemeldungen und Termine LJV-Niederwildtag September organisiert der Landesjagdverband Sachsen- Anhalt einen Niederwildtag zum Thema EURArtenschutz der AgrarlandschaftEUR Interessierte sind herzlich eingeladen und können sich jetzt noch einen der Plätze für das Symposium sichern weiterlesen EU-Richtlinie keine Einschränkungen für Jäger Büro Andreas Schwab Mitglied des Europäischen Parlaments Binnenmarktpolitische Sprecher der EVP-Fraktion Europäischen Parlament Brüssel den Juli EU-Richtlinie Feuerwaffen wird keine Einschränkungen für deutsche Jäger und Sportschützen nach sich ziehen Die von der Kommission initiierte Verschärfung des EU-Waffenrechts wird Deutschland nur geringe Auswirkung hule testen Anmeldungen für Klassen und Gruppen richten sie bitte Viola Techentin info ljv-sachsen-anhalt oder telefonisch unter weiterlesen Newsletter-Anmeldung Weiterführende Links www jagdverband www wild-auf-wild www jagdverband delernort-natur www haus-des-waldes www landesforstbetrieb sachsen-anhalt delfbindexlfb htm www wildtierforschung www jagd-fakten window cookieconsent options message Diese Webseite v Liste der invasiven gebietsfremden Arten aufgenommen deren primäres Ziel die Eindämmung der Arten ist Der Deutsche Jagdverband DJV befür weiterlesen Landesbläsertreffen Elbauenpark Magdeburg Zum Landesbläsertreffen Samstag dem September lädt der Landesjagdverband Sachsen- Anhalt recht herzlich nach Magdeburg den Elbauenpark ein Auf dem Landeserntedankfest präsentieren sich die Jagdhornbläser mit einem eigenen Pr erwendet Cookies Ihnen ein angenehmeres Surfen ermöglichen und alle Funktionen optimal bereitzustellen Mit der weiteren Nutzung der Webseite stimmen Sie der Verwendung von Cookies ausdrücklich dismiss Danke für den Hinweis learnMore Mehr Informationen link www ljv-sachsen-anhalt html theme light-top push arguments new Date async src parentNode insertBefore window www ga ga create UA-56946269-1 auto ga send pagevi e bei weitem nicht effektiv sind wie der Einsatz von Fallen Selbst durch äsungs- und biotopverbessernde Maßnahmen alleine können wir unserem Niederwild nicht genügend helfen auf stabile Besätze gelangen Deshalb führt der Landesjagdverband einen Lehrgang zur Raubwildbejagung durch weiterlesen Schulanfang der Natur Kindergarten- oder Schülergruppen sind wieder herzlich Willkommen ihr Wissen unserer rollenden Waldsc ogrammhöhepunkt Vor vielen tausend Besuchern des Landeserntedankfestes besteht die Möglichkeit jagdliches Brauchtum vor stellen die Pflege traditioneller und zeitgenössischer Jagdmusik vor tragen und weiterlesen Fangjagdseminar- sind noch Plätze frei! Lehrgang Raubwildbejagung mit Schwerpunkt Fangjagd Die Ergebnisse verschiedener Niederwildprojekte haben gezeigt dass eine Raubwildbejagung nur mit Flinte und Büchs en haben Der Binnenmarktausschuss des Europäischen Parlaments hat Juli für eine entsprechende weiterlesen EU- Liste invasiver Arten gebietsfremde Tier- und Pflanzenarten sind laut Europa unerwünscht EUR darunter auch der Waschbär dessen Verbreitung und Populationszahl Deutschland rasant steigt Doch wer ihn zurück drängen will muss dafür Geld die Hand nehmen Die Europäische Union hat den Waschbär Procyon lotor die Lernort Natur Landestrophäenbewertung Wildtiererfassung Streckenentwicklung Biotopförderung Duokulturen Netzwerk Niederwild Lebensraum Feldflur Wildkatze Wolf Steinkauzprojekt Großtrappenschutz Seeadler Lernort Natur Das Projekt Steckbriefe Wildtiere Wanderausstellung Jagd und Naturschutz Vorsprung durch Ursprung Akzeptanz durch Nachhaltigkeit Niederwildtag Willkommen und Weidmannsheil der Landesjagdverband Sach | | ljv-sachsen-anhalt.de

1. ljv-sachsen-anhalt.de PR-Navi.de
2. ljv-sachsen-anhalt.de PR-Navi.de


Sex xXx fick Erotik sexy hardcore
etze und Verordnungen Behörden Rechtsberatung für Mitglieder Versicherungen Download Wild au Brandenburg Wildrezepte Mitteilungsblatt Verhalten bei Wildunfällen Presse Download Pressemitteilungen Seite auswählen September glänzend aufgelegter LJVB-Präsident gewann viel SympathieDer aktuelle Antenne-Stammtisch de rbb beschäftige sich mit der Frage WirdEUR im Wald Wild? Wieviel September passiert den BundesratBaldige Inkrafttreten der Neuregelung Selbstladebüchsen September BRANDENBURG lädt zusammen mit der HNEE zum Jagd-Stammtisch nach EberswaldeAm September plant da rbb-Studio Frankfurt Oder zusammen mit der Hochschule für nachhaltige Entwicklung Eberswalde eine tp-caption startslider-text font-size line-height font-weight font-family Open San color text-decoration none padding 20px 20px 70 rgba 0 0 border-width border-color rgb 214 border-style none PREPARE PLACEHOLDER FOR - setREVStartSize tpopt new Object tpopt 960 tpopt 600 tpopt container rev 1 tpopt fullScreen off tpopt container closest rev wrapper cs height tpopt container tpopt parseInt tpopt container 0 tpopt parseInt tpopt container 0 tpopt startwidth tpopt startheight tpopt if tpopt bh1 tpopt 1 tpopt Math round tpopt startwidth tpopt und tpopt on tpopt if tpopt fullScreen tpopt cow tpopt container parent coh window if tpopt fullScreenOffsetContainer! undefined try offcontainer tpopt fullScreenOffsetContainer split each offcontainer function t coh t true coh Kein Artenschutz ohne nachhaltige Jagd September Die CITES-Weltkonferenz beginnt kommenden Samstag Die Delegierten beraten über den Handel mit gefährdeten Tieren und Pflanzen Der DJV fordert ein Bekenntni zur nachhaltigen Auslandsjagd und warnt vor unnötiger EU-Bürokratie mehr lesen Afrikanische Schweinepest breitet sich weiter au 26 August DJV keine Wurst- und Fleischprodukte achtlo an der Straße entsorgen Wildschweinjagd erleichtern mehr lesen Chronische Auszehrkrankheit Skandinavien Wa Jäger wissen sollten August In Norwegen ist bei einem Rentier und zwei Elchen die au Nordamerika stammende chronische Auszehrkrankheit CWD nachgewiesen worden Behörden zufolge könnte der Erreger durch Hirsch-Urin au den USA importiert worden sein Wie gefährlich die Wildtierkrankheit ist und wa deutsche Jäger wissen müssen fasst der DJV zusammen mehr lesen EURInteressen der Mitglieder al Gradmesser meiner EntscheidungenEUR August Interview mit Matthia Schannwell neuer Geschäftsführer de LJVB mehr lesen Alle Meldungen Beitrittserklärung Jetzt Mitglied LJVB werden Antrag auf Mitgliedschaft Gebühr für Trichinenproben Der LJVB stellt Musterantrag zur Gebührenbefreiung zur Verfügung Antrag auf Befreiung Nächste Termine Keine Veranstaltungen Alle Termine Newsletter Anmeldung Immer aktuell informiert Melden Sie sich bei unserem Newsletter und Sie werden automatisch per E-Mail über alle wichtigen Neuigkeiten rund den LJVB informiert Vorname Nachname E-Mail-Adresse Anmelden Newsletter Anmeldung Immer aktuell informiert Melden Sie sich bei unserem Newsletter und Sie werden automatisch per Email über alle wichtigen Neuigkeiten informiert verpassen Sie keine Aktivitäten Termine oder Neuigkeiten rund den Landesjagdverband Brandenburg Vorname Nachname E-Mail-Adresse Anmelden PRÜFLINGE erwerben pro Jahr da Grüne Abitur Brandenburg PROZENT der Jägerinnen und Jäger Land sind Mitglied LJVB JÄGERINNEN und Jäger leben Brandenburg und gehen hier ihrer Passion nac 222 et-footer-nav rgba 0 0 footer-bottom 222222 footer-bottom et-social-icon font-size media only screen and 981px header left et-top-navigation header split et-top-navigation 0 header left et-top-navigation nav li et header split et-top-navigation nav li padding-bottom et header split centered-inline-logo-wrap 149px margin -149px et header split centered-inline-logo-wrap logo 149px pb svg logo header split centered-inline-logo-wrap logo 149px header centered top-menu a padding-bottom et header centered main-header logo container 149px header centered logo 75 pb svg logo header centered logo 75 header centered hide primary logo main-header not et-fixed-header logo container header centered hide fixed logo main-header et-fixed-header logo container 26 et header left et-fixed-header et-top-navigation header split et-fixed-header et-top-navigation 0 header left et-fixed-header et-top-navigation nav li et header split et-fixed-header et-top-navigation nav li padding-bottom et header centered header main-header et-fixed-header logo container 30px header split et-fixed-header centered-inline-logo-wrap 30px margin -30px et header split et-fixed-header centered-inline-logo-wrap logo 30px pb svg logo header split et-fixed-header centered-inline-logo-wrap logo 30px et-fixed-header top-header et-secondary-nav ul 444444 et-fixed-header top-menu a font-size et-fixed-header top-menu et-fixed-header search icon before et-fixed-header top et-search-form input et-fixed-header search form container input et-fixed-header close field after et-fixed-header et-top-navigation et-cart-info color !important et-fixed-header search form container input -moz-placeholder color !important et-fixed-head h Partner pkwteile und xe0ff Rechtsberatung und xe0d9 Versicherungen und xe063 Wildunfall wa tun? und xe108 Mitglied werden Kontakt Anfahrt Sitemap-Disclaimer Impressum Meldungen Suche nach Landesjagdverband Brandenburg AGB pb image margin-left et section display none pb column background-color rgba 0 0 et cta et promo button fff 0 body button custom icon page-container pb cta et promo pb button after font-size body page-container pb cta et promo pb button hover rgba 255 0 !important letter-spacing padding-left 7em padding-right body page-container pb cta et promo pb button hover after opacity body page-container pb cta et promo pb button after font-size opacity et number counter et number counter padding-top !important pb text padding-right !important padding-bottom !important padding-left !important pb text padding-right !important padding-bottom !important padding-left !important pb column background-color rgba 0 0 et cta et promo font-size padding-top !important padding-right !important padding-bottom !important padding-left !important pb number counter et number counter padding-top !important pb column background-color rgba 0 0 et column background-color rgba 0 0 et number counter et number counter padding-top !important pb text padding-bottom !important body page-container pb cta et promo pb button letter-spacing font-size et code background-color fff 1px solid ddd margin-bottom !important margin-top body button custom icon page-container pb cta et promo pb button after font-size et cta et promo button 0 fff pb code 10px body page-container pb cta et promo pb button after font-size opacity body page-container pb cta et promo pb button hover after opacity et cta et pr document Landesjagdverband Brandenburg Stark für die Jagd context schema org type WebSite url www ljv-brandenburg name Landesjagdverband Brandenburg Stark u00fcr die Jagd potentialAction type www ljv-brandenburg ? search term string query-input required name term string context schema org type Organization url www ljv-brandenburg sameA name Landesjagdverband Brandenburg logo www ljv-brandenburg wp-content upload 2015 LogoLJVBgros png window baseUrl w org image core emoji ext png source concatemoji www ljv-brandenburg wp-include j wp-emoji-release min js?ver 4 !function b function a d f createElement canva g getContext und getContext h String fromCharCode g und fillText? textBaseline top font 32px Arial a? fillText 55356 55356 0 f toDataURL length diversity a? fillText 55356 0 c getImageData 16 1 data fillText 55356 55356 0 c getImageData 16 1 data c c c c d! simple a?g fillText 55357 0 g fillText 55356 0 0! getImageData 16 1 data !1 e c createElement c src c type b head appendChild f c support simple d unicode8 unicode8 diversity DOMReady c readyCallback c DOMReady c support simple und support flag und support unicode8 und support diversity function readyCallback addEventListener? addEventListener DOMContentLoaded !1 addEventListener load !1 attachEvent onload b onreadystatechange complete readyState und readyCallback c source concatemoji?e concatemoji wpemoji und twemoji und f twemoji f wpemoji window document window img wp-smiley img emoji display inline !important none !important box-shadow none !important 1em !important margin 07em !important vertical-align 1em !important none !important padding !important tp-caption color ff7302 text-shadow none -webkit-transition all 2 ease-out -moz-transition all 2 ease-out -o-transition all 2 ease-out -ms-transition all 2 ease-out tp-caption hover color ffa902 document ready CUSTOM CONTENT LOADING ajaxRevslider obj type Post Type obj ID Content Load obj aspectratio The Aspect Ratio the Container Media obj selector The Container Selector where the Content Ajax will injected i done via the Essential Grid Return content data action ajax call front data client action get html data token data type obj type data obj data aspectratio obj aspectratio SYNC REQUEST ajax type post url www ljv-brandenburg php dataType json data async succes function ret textStatu XMLHttpRequest ret succes true content ret data error e console log FIRST THE CONTENT WHEN I LOADED return content CUSTOM FUNCTION REMOVE THE ajaxRemoveRevslider obj jQuery obj selector rev revkill EXTEND THE CONTENT LOADING TYPE WITH TYPE AND extendessential setInterval if fn tpessential undefined clearInterval extendessential typeof fn tpessential default ! undefined fn tpessential default ajaxType push type func killfunc openAnimationSpeed 3 type Name the Post load via into the Essential Grid Container func the Name which Called once the Item with the Post Type ha been clicked killfunc to kill case the Window going be removed before Remove ! openAnimationSpeed how quick the Content window should animated default 0 30 window plugin version 1 ssba img 25px !important padding border box-shadow none !important display inline !important vertical-align middle ssba text-decoration none 0 none color dae5f7!important font-weight bold woocommerce respond input submit woocommerce-page respond input submit woocommerce content input button woocommerce-page conte omo line-height !important body page-container pb cta et promo pb button letter-spacing font-size body page-container pb cta et promo pb button hover rgba 255 0 !important letter-spacing padding-left 7em padding-right body page-container pb cta et promo pb button 2px !important 3px letter-spacing font-size body page-container pb cta et promo pb button hover 3px letter-spacing padding-left 7em padding-right body page-container pb cta et promo pb button hover after opacity body page-container pb cta et promo pb button after font-size 6px opacity body button custom icon page-container pb cta et promo pb button after font-size body page-container pb cta et promo pb button hover 3px letter-spacing padding-left 7em padding-right body page-container pb cta et promo pb button 2px !important 3px letter-spacing font-size body page-container pb cta et promo pb button hover after opacity body page-container pb cta et promo pb button after font-size 6px opacity body button custom icon page-container pb cta et promo pb button after font-size et blog grid pb post media only screen and 981px pb section padding-top padding-bottom jQuery input name eme submit button et promo button pb button document ready jQuery et-social-icon attr blank document ready jQuery leaderboard-top prependTo body function pb accordion pb toggle open et toggle close et toggle open pb accordion pb toggle click thi setTimeout thi closest pb accordion et accordion toggling function o r m GoogleAnalyticsObject i i function r i q push argument i l new Date createElement m getElementsByTagName 0 async a src m parentNode insertBefore m window document www comanalytic j ga ga create UA-63396611-3 auto ga send pageview nt input button woocommerce-message woocommerce-error woocommerce-info d10019 !important search icon hover mobile menu bar before et-social-icon hover pb sum pb pricing a pb pricing table button overlay before entry-summary price in woocommerce div product span price woocommerce-page div product span price woocommerce content div product span price woocommerce-page content div product span price woocommerce div product price woocommerce-page div product price woocommerce content div product price woocommerce-page content div product price pb member social link a hover woocommerce star-rating span before woocommerce-page star-rating span before pb li hover pb filterable portfolio pb portfolio filter li active pb filterable portfolio pb portofolio pagination li active pb gallery pagination li active wp-pagenavi span current wp-pagenavi hover nav-single posted a color d10019 pb contact submit password protected form submit button pb layout light pb newsletter button comment-reply-link form-submit input pb layout light pb promo button pb layout light pb more button woocommerce button alt woocommerce-page button alt woocommerce button alt woocommerce-page button alt woocommerce input button alt woocommerce-page input button alt woocommerce respond input submit alt woocommerce-page respond input submit alt woocommerce content input button alt woocommerce-page content input button alt woocommerce button woocommerce-page button woocommerce button woocommerce-page button woocommerce input button woocommerce-page input button color d10019 h4 color d10019 nav ul mobile menu li before pb pricing before blockquote d10019 pb counter amount pb featured table pb pricing heading quote cont ent link content audio content d10019 container pb row pb et container pb section pb title container pb section pb title featured container pb header not pb fullscreen pb header container 960px boxed layout page-container fixed nav boxed layout page-container top-header fixed nav boxed layout page-container main-header boxed layout page-container container boxed layout page-container pb row 1120px color cc7514 main-header nav ul main-header mobile menu ebf5f4 top-header et-secondary-nav ul 444444 header centered mobile nav select page header split mobile nav select page nav text color light top-menu a nav text color dark top-menu a top-menu et mobile menu a nav text color light mobile menu a nav text color dark mobile menu a search icon before search form container input span close field after et-top-navigation et-cart-info mobile menu bar before color et form container input -moz-placeholder color et form container input -webkit-input-placeholder color et form container input -ms-input-placeholder color top-header et-secondary-nav li top-header et-social-icon before font-size top-menu a font-size body vertical nav container search form container input font-size !important top-menu current-menu-ancestor top-menu current-menu-item et color scheme red top-menu current-menu-ancestor et color scheme red top-menu current-menu-item et color scheme pink top-menu current-menu-ancestor et color scheme pink top-menu current-menu-item et color scheme orange top-menu current-menu-ancestor et color scheme orange top-menu current-menu-item et color scheme green top-menu current-menu-ancestor et color scheme green top-menu current-menu-item color main-footer h4 color d10019 li before 222 er search form container input -webkit-input-placeholder color !important et-fixed-header search form container input -ms-input-placeholder color !important et-fixed-header top-menu current-menu-ancestor et-fixed-header top-menu current-menu-item color !important media only screen and 1200px pb row pb section single pb pagebuilder layout full page post meta wrapper padding-top et section pb section first padding-top inherit pb section padding media only screen and 980px pb section first padding-top inherit pb section padding media only screen and 767px body page-container sidebar 19 body page-container left-area 81 right sidebar main-content container before right !important left sidebar main-content container before left !important body background-image url www ljv-brandenburg jpg repeat top left fixed 2109-0 info ljv-brandenburg Facebook Der LJVB Auftrag Präsidium Mitgliedsverbände Geschäftsstelle Mitglied werden Ihre Vorteile al Mitglied Mitbestimmung Junge Jäger Jagd und Natur Jagd ist Naturschutz Fakten gegen Vorurteile Jagdliche Brauchtum Aus- und Weiterbildung Wettbewerbe Neozoen Lehrrevier Groß Kreutz Projekt Artenreiche Flur Heimische Wild Wa ist Wild Schalenwild Raubwild Federwild sonstige Niederwild Wölfe Brandenburg Projekt WILD Jäger werden Info zur Jägerprüfung Anmeldung zur Prüfung Hinweise zur Prüfungsteilnahme Prüfungstermine Prüfungsfragen Prüfungsgebühren Durchgefallen und wa nun? Online-Test Landesjagdschule Lernort Natur Schießen Schiessen Wettbewerbe Schießstände Hunde Brauchbarkeit Jagdgebrauchshundeausgleichsfond Gespanne für den jagdlichen Einsatz Schliefenanlagen Schwarzwildgatter Rassezucht- Prüfungsvereine Prüfungstermine Nachrichten Termine Ges | ljv-brandenburg.de |
sex
Der LJVB ist die anerkannte Vereinigung der J gerinnen und J ger in Brandenburg Als Naturschutzverband setzt er sich f r Jagd und Umwelt ein

1. ljv-brandenburg.de PR-Navi.de
2. ljv-brandenburg.de PR-Navi.de

Sex xXx fick Erotik sexy hardcore | ljuonline.de
Internet Kommunikation Downloads Software Kfz Automobile Zubehör Car | | ve-System Auf der SPS Drives Nürnberg wurde November das neue induktive batteriegestützte Hubtisch-Versorgungskonzept für Skillets vorgestellt Weiterlesen EUR Flexlift ACCU-Drive-System FAW Foshan FAW-Volkswagen Automobile Joint Venture mit China FAW Group Corp hat mit der Bauphase des Montagewerkes Foshan begonnen Weiterlesen EUR FAW Foshan Zurück Vorwärts Downloads Info-Broschüren Flyer Techn Dokumentation Software GSDEDS Files RMA Zertifikate AGB Unsere Produkte Steuerungen für Elekt ragen Sie uns nach der für Sie besten Lösung! Weiterlesen News Informationen Virtuelle Inbetriebnahme Neue Funktionen für die virtuelle Inbetriebnahme mit iDM SyMa Weiterlesen EUR Virtuelle Inbetriebnahme Kühlhaussteuerung LJU beendet erfolgreich die Entwicklung für Steuerungen zum Einsatz Kühlhäusern Weiterlesen EUR Kühlhaussteuerung ST-870 ausgeliefert! Umfangreiche Prüfungen bestanden - Einsatz erfolgt bei verschiedenen Anwendern Weiterlesen EUR ST-870 ausgeliefert! Flexlift ACCU-Dri iwik js type textjavascript 3E 3Cscript 3E try piwikTracker Piwik getTracker pkBaseURL piwik php piwikTracker setDownloadExtensions 7zaacarcarjasfasxavibincsvdocexeflvgifgzgziphqxjarjpejpegjsmp2mp3mp4mpempegmovmoviemsimsppdfphpspngpptqtmramrarseasittartgzorrenttxtwavwmawmvwpdxlsxmlzzip piwikTracker setDocumentTitle LJU piwikTracker trackPageView piwikTracker enableLinkTracking catch err window responsinav breakpoint 979 setTimeout ajax systemcroncron txt complete t responseText0 parseIn sierungstechnik GmbH ist Anbieter von Steuerungs- und Kommunikationslösungen für Elektrohängebahnen EHB industriellen Bodenförderern Bodentransportsystemen Wegmesssystemen induktiver Energieübertragung sowie Dienstleistungen Weiterlesen Referenzen Der Name LJU steht für Jahre fundierte Praxiserfahrung bei der Konstruktion Lieferung und dem von Steuerungstechnik für industrielle Förderanlagen Eine umfangreiche Auswahl von Standard- Spezial- und Ersatzlösungen steht zur Anwendung bereit F r Leitsystem NEU - das iDM Busmastersystem von LJU! Weiterlesen Induktive Energieübertragung stehen zahlreiche Komponenten für Induktive Energieübertragung zur Verfügung Einspeisemodule Induktiv-Pickups verschiedener Größen- und Leistungsklassen Anschlussmodule und Kabel Beratung und inklusive NEU - Ladesystem für Carry Ladematten und Regler! Weiterlesen LJU Automatisierungstechnik GmbH Sitemap Kontakt Anmeldung Suchen Karriere ready accordion Put custom options here content header div toggler collapsible true active activate tog tgs div toggler tgs active tog active tgs next div accordion attr aria-hidden true tog next div accordion attr aria-hidden div toggler focus div toggler attr tabindex this attr tabindex blur this attr tabindex click activate this keypress keyCode activate this ready each cte data-config split new Swipe Put custom options here auto parseInt speed parseInt continuous parseInt menu cte ready caroufredsel krioImageLoader readyLoad carouFredSel re utton caroufredsel next pagination container caroufredsel pagi wrapper caroufredsel wrapper window domready links filter data-lightbox null links mediabox Put custom options here href title data-lightbox data this data-lightbox split this data und data-lightbox match data mbImage swipe direction left ? mbNextLink fireEvent click mbPrevLink fireEvent click id pkBaseURL https location protocol ? https www ljuonline depiwik http www ljuonline depiwik write unescape 3Cscript src pkBaseURL p sponsive true direction right onCreate data items visible start random crossfade duration pauseOnHover resume onBefore data items old visible onAfter data items visible auto timeoutDuration wrapper caroufredsel wrapper ready caroufredsel krioImageLoader readyLoad carouFredSel responsive true auto padding onCreate data items visible items duration pauseOnHover resume onBefore data items old visible onAfter data items visible auto timeoutDuration delay prev button caroufredsel prev next b rohängebahnen Alle erforderlichen Komponenten einer Box Controller Umrichter EAs Sicherheitsrelais Leistungsbereich zwischen und Konfigurationsorientiert setzen Sie Ihre Parameter und fahren Sie los NEU - Serie ST-8xx Start! Weiterlesen Kommunikation für Industrielle Fördertechnik Schienenbus oder Induktivbus - beide Systeme haben gleiche Datenstruktur und können frei parametriert werden besteht Vollzugriff auf alle mobilen Teilnehmer zum Datenaustausch zwischen Fahrwagen und SPS undode LJU - LJU Automatisierungstechnik GmbH Potsdam Navigation überspringen LJU Unternehmen News Referenzen Firmenchronik Firmenphilosophie Steuerungstechnik EHB-Steuerungen Wegmesssysteme und PCM-Ansteuerung Busmaster-Systeme Zubehör-Software Induktivtechnik Anwendungen Maschinenbau der Logistik Downloads Broschüren Flyer Technische Dokumentation Software Zertifikate Lieferbedingungen Kontakt Europa Übersee Anfahrt Kundenzufriedenheit Karriere Suchbegriffe LJU-DE LJU Willkommen LJU Automati | |
| 1. PR-Navi.de ljuonline.de
2. ljuonline.de PR-Navi.de

Sex xXx fick Erotik sexy hardcore |
interkulturell verst Evangelische Landjugendakademie Sep 19 EUR Sep 20 ganztägig Die Jahreszeiten haben in den verschiedenen Kulturen unterschiedliche Feste hervorgebracht Durch die künstlerische Gestaltung dieser Anlässe werden pädagogische Fachkräfte zu EURKulturdolmetscherinnen und KulturdolmetschernEUR Jahresfeste die sich in unserem Kulturkreis bildeten sowie sich an Vorgängen in und hellip ganztägig Kommunikation u Verhandlung und ndash W Evangelische Landjugendakademie Kommunikation u Verhandlung und ndash W Evangelische Landjugendakademie Sep 19 EUR Sep 21 ganztägig Ob im Beruf oder zu Hause immer und überall muss der Mensch kommunizieren Warum geht das oft schief was kann der Einzelne tun wenn er oder sie falsch verstanden wird und wie setzen Einzelne ihre und hellip Sep 26 Mo ganztägig Kita als Kunstwerkstatt ermutigt Evangelische Landjugendakademie Kita als Kunstwerkstatt ermutigt Evangelische Landjugendakademie Sep 26 EUR Sep 27 ganztägig Förderung der kindlich-körperlichen Kreativität eigene Gestaltungskraft und individuelle Ausdrucksweise lassen eine substantielle persönliche Ausdrucksform entstehen Die Schärfung der eigenen Wahrnehmung wird angeleitet und trainiert kein spezieller Tanzstil oder eine besondere Maltechnik muss gelernt werden Erlebtes und hellip ganztägig Wege aus dem Chaos und ndash Wege zum Au Wege aus dem Chaos und ndash Wege zum Au Sep 26 EUR Sep 28 ganztägig Ein Seminar zur Work-Life-Balance Arbeiten Sie nur oder leben Sie auch? Ein Seminar zur left 120px text-align left margin 0px 0px cr ipe item input type text 100 cr ipe item textarea 120px cr ipe item select 120px cr ipe item p cr ipe item select padding 4px solid ccc color 333 margin padding 2px cr ipe item textarea focus input type text focus solid cr ipe item input textarea padding 3px margin 2px solid ccc cr ipe item input type checkbox input type radio 15px cr error font-size 1 1em padding clever form error f99 color fff solid f22 !important clever form note 3px position absolute display inline padding 2px 4px font-weight bold f2ecb5 color 000 font-size 12px !important cr body 480px cr site A7C855 cr header transparent color cr body transparent font-size 12px color cr page border-width border-style none width 200px cr hr ccc color cr font-size 12px Anrede Frau Herr Vorname Nachname E-Mail Anmelden Abmelden Jetzt senden NEU Programm 2016 Evangelische Landjugendakademie Altenkirchen Realisierung eCouleur Impressum Datenschutz AGB Footernavigation paq push trackPageView paq push enableLinkTracking function u www lja depiwik paq push setTrackerUrl u piwik php paq push setSiteId 1 g createElement script s getElementsByTagName script g type textjavascript g async true g defer true g src u piwik js s parentNode insertBefore g s details Auszeichnung für das Pädagogikkonzept Lebendiges Lernen vom Land im Land der Ideen per Klick weiterlesenEUR detailsJahresprogramm 2016 als Broschüre anfordernoder per Klick zum DownloadEUR detailsJahresbericht 2015 Thema Übergänge unction url ? Chrome 26 1410 63 Safari 537 31WordfenceTestMonBot test navigator userAgent return addEvent function evt handler window addEventListener addEventListener evt handler false window attachEvent attachEvent on evt handler removeEvent function evt handler window removeEventListener removeEventListener evt handler false window detachEvent detachEvent on evt handler evts contextmenu dblclick drag dragend dragenter dragleave dragover dragstart drop keydown keypress keyup mousedown mousemove mouseout mouseover mouseup mousewheel split logHuman function wfscr createElement script wfscr type textjavascript wfscr async true wfscr src url und r Math random getElementsByTagName head getElementsByTagName body appendChild wfscr for i i evts length i removeEvent evts i logHuman for i i evts length i addEvent evts i logHuman www lja de?wordfence logHuman 1 und hid 0214B2B519435FF27A4994D191684BDC jQuery function window load window removeLoading setTimeout function load addClass loader-removed fadeOut 500 500 window one dt removeLoading function ! load hasClass loader-removed clearTimeout window removeLoading load addClass loader-removed fadeOut 500 main wpb wrapper blog-media display table-cell !important vertical-align top wpb wrapper blog-content display table-cell !important padding 25px 15px !important Startseite Info Boxen aio-icon-header h3 aio-icon-title color fff font-size !important custom 1464292706058 margin-bottom !important border-top-width !important 007ab5 !important sche Landjugendakademie Sep 29 EUR Okt 3 ganztägig Schritt für Schritt erschließen sich ländliche Lebensräume durch Wanderouten die vom LandFrauenverband für Gäste in der Region ausgewiesen sind Das Seminar wird zu einem besonderen Erlebnis weil neben den Wanderungen auch die Begegnung mit ortsansässigen und hellip Sep Fr ganztägig Solidarische Landwirtschaft und ndash Ne Solidarische Landwirtschaft und ndash Ne Sep ganztägig Neue Chancen der Direktvermarktung durch solidarische Landwirtschaft? Solidarische Landwirtschaft SoLaWi bedeutet gemeinschaftsgetragene Landwirtschaft und ist eine Vermarktungsform für landwirtschaftliche Produkte daher auch im englischen EURcommunity supported agricultureEUR Durch aktive Mitarbeit im Land- und Gartenbau lernen und hellip Kalender anzeigen Facebook Fan BoxKontaktinfos Evangelische Landjugendakademie Altenkirchen Dieperzbergweg 13 - 17 57610 Altenkirchen Westerwald TELEFON 02681 95 16 - täglich von 8 00 - 16 00 Uhr FAX 02681 95 16 - 90 E-MAIL info lja de WEB lja de Newsletter cr site efefef text-align left cr header 000 cr body efefef padding cr page border-width border-color border-style solid 640px cr page border-width border-color border-style solid cr font normal 12px Arial Helvetica sans-serif cr header logo min-height cr header text p display block margin 5 padding cr ipe item padding 0px margin cr ipe item inactive display none cr hr ccc imprint font-size 8em cr captcha padding-left cr ipe item itemname color 666 display block float sorge Natur Umwelt Nachhaltigkeit Pädagogische Arbeit in der Kita Perspektiven ländlicher Räume Fachbereich LJA Fachbereich LVHS TagungshausGästeanfrage Ausstattung Konferenz- Seminar- und Werkräume Übernachtung Verpflegung Zertifizierung Freizeit und Umgebung Preise und Ermäßigungen Kontakt und AnreiseSeminaranmeldung Anreise per Bahn Anreise per PKW Unter unserem Dach Vereint finden Sie LVHS EDL IRCA u v m unter dem Dach der LJA Zum Programm für Verantwortliche in Gemeindearbeit Pädagogik Gruppen aller Generationen Zur Anmeldung Die neuen Kurse sind da! Melden Sie sich jetzt einfach über unser Formular an Zertifizierung Neben einer Bio-Zertifizierung sind wir ausgezeichnet mit dem Grünen Gockel Herzlich Willkommen! Informieren Sie sich ausführlich über die Evangelische Landjugendakademie Altenkirchen die zertifizierte Tagungsstätte mit Atmosphäre Viel Spaß auf unserer Website! Herzlichst Ihr LJA Team Der Wunsch nach Frieden EURDer Wunsch nach FriedenEUR wird präsentiert als öffentliche Ausstellung bis zum 19 09 2016 Von montags bis freitags zwischen 00 Uhr und 16 00 Uhr lädt die Evangelischen Landjugendakademie Dieperzbergweg 13-17 in Altenkirchen zum Besuch ein Im Zentrum der Ausstellung stehen politische Zeichnungen von dem Kurden Abdulhalim Abrahim Sein Friedenswunsch in Bleistift und Pastelltönen wird unterstrichen durch die und hellip Details 26 August 2016Allgemein Ästhetische und kulturelle Bildung für Nachhaltige Entwicklung BNE Fachbereich LJA Neuigkeiten Quo vadis J Work-Life-Balance Die Herausforderungen der modernen Berufswelt wie Arbeitsverdichtung und Zeitdruck benötigen ein hohes Maß an Konzentration und Energie Prioritäten setzen sich und hellip ganztägig Weiterbildung in Seelsorge Modul I Weiterbildung in Seelsorge Modul I Sep 26 EUR Sep ganztägig In diesem Kurs bringen die Teilnehmenden ihre Seelsorgegespräche aus der eigenen Gemeindepraxis mit Ziel des Kurses ist die Stärkung der Kommunikationsfähigkeit und der seelsorglichen Kompetenz Dazu arbeiten wir mit den Kurselementen der KSA Selbsterfahrung in und hellip Sep 28 Mi ganztägig Jugendwelten und ndash Jugend 2016 Modu Jugendwelten und ndash Jugend 2016 Modu Sep 28 EUR Sep ganztägig Vom Sozialraum zur schönen neuen Welt Jugendliche wollen heute alles Erfolg im Beruf eine ansehnliche Kariere Spaß mit Freunden viele Reisen und natürlich eine eigene Familie Dabei sind sie nett intelligent ehrgeizig und angepasst Alle und hellip ganztägig Methoden Box und ndash art und moving Methoden Box und ndash art und moving Sep 28 EUR Sep ganztägig Im Workshop lernen Mitarbeiterinnen und Mitarbeiter in der Kinder- und Jugendarbeit Methoden der Kunst- und Tanzpädagogik kennen die bei den Kindern und Jugendlichen kreative Kompetenz fördern und etwas mit Biografiearbeit zu tun haben Diese helfen und hellip Sep 29 Do ganztägig und bdquo erwandern und ndash erleben und ndash erholen und ldquo Evangelische Landjugendakademie und bdquo erwandern und ndash erleben und ndash erholen und ldquo Evangeli Evangelische Landjugendakademie Altenkirchen function createCookie new Date setTime getTime expires toGMTString cookie path function readCookie for cookie split Allgemein edit-link display none Top Bar top-bar hover color text-decoration underline Startseite Titel solid aac855 rsTitle font Source Sans Pro Helvetica Arial Verdana sans-serif !important rsHomePorthole rsCapt text-align left padding !important rsHomePorthole rsCLink ps-link display none rsHomePorthole rsTitle !important text-shadow none !important fff !important opacity !important font-size !important padding !important color !important rsHomePorthole rsTitle text-decoration none !important rsHomePorthole rsTitle hover text-decoration underline !important rsCapt text-align left !important Header fancy-header wf-td !important fancy-header !important entry-title h1-size none repeat fff opacity !important padding entry-title h1-size -moz-max-content -webkit-fit-content fit-content breadcrumbs display none !important BLOG entry-meta author display none Grid Element owl-carousel owl-item img btn-blue button btn-blue color fff btn-blue hover button btn-blue hover fff color !important solid grid-item-zone-c-right gitem-animated-block grid-item-zone-c-right gitem-zone-c gitem-zone !important content url www lja dewp-contentuploadslja-listenpunkt-gruen png input type text input type tel input type url input type email input type number input type date input type range input type password select textarea color !important sid ugend von Europa? In Frankreich läuft die Fußball-EM Doch so recht kommt sie nicht in Schwung Der Start war holprig und von brutalen Straßenkampf-szenen durch rivalisierende Hooligans gekennzeichnet die Fanmeilen fürs Public-Viewing oft viel leerer als erwartet Wir haben noch gut die positiven friedlichen Bilder der WM im eigenen Land im Kopf und spüren dass das positive euphorische und hellip Details 29 Juni 2016Neuigkeiten Newsletter Solidarische Landwirtschaft Verbraucheraufklärung und ökologischer Land- und Gartenbau sind in diesem Jahr inhaltliche Schwerpunkte im Referat nachhaltige Entwicklung ländlicher Räume Die Brücke zwischen beiden schlägt das neue Konzept der solidarischen Landwirtschaft Dabei arbeiten ProduzentInnen und KonsumentInnen sehr eng zusammen teilen die Erträge und das Risiko Die niedrigste Schwelle der Beteiligung liegt bei den Gemüse-Kisten-Abonnements in der direkten und hellip Details 28 Juni 2016Neuigkeiten Newsletter Suche Nächste Termine Sep 16 Fr ganztägig ADHS na und hellip und ndash Interventionsmög ADHS na und hellip und ndash Interventionsmög Sep 16 EUR Sep 18 ganztägig Die Anzahl der auffälligen Kinder und Jugendlichen vergrößert sich zunehmend ADHS ist dabei eine häufig gestellte Diagnose aber nicht jede Verhaltensauffälligkeit bedeutet ADHS Die Gründe für verhaltensauffällige Kinder und Jugendliche sind sehr vielschichtig Das Seminar und hellip Sep 19 Mo ganztägig Jahresfeste interkulturell verst Evangelische Landjugendakademie Jahresfeste border-top-color ffeb00 !important border-top-style solid !important 3px !important wpb animate when almost visible opacity 1 Skip to content 02681 - 51 60info lja deDieperzbergweg 13 - 17 in 57610 Altenkirchen Westerwald Evangelische Landjugendakademie Altenkirchen Home Aktuelles AkademieBundesweite Fort- und Weiterbildungseinrichtung LJAFÖJ-Rheinland-Pfalz LVHSFördervereinSorgentelefon Geschäftsstelle EDL Rheinland Evangelischer Dienst auf dem Lande in der EKD EDL International Rural Churches Association Europe IRCA Kirche im ländlichen Raum Unser Team Interessante Links ProgrammÄsthetische und kulturelle Bildung Jugendarbeit Jugendpolitische Bildung Kirche sein Gemeinde leben Leiten beraten Seelsorge Natur Umwelt Nachhaltigkeit Pädagogische Arbeit in der Kita Perspektiven ländlicher Räume Fachbereich LJA Fachbereich LVHS TagungshausGästeanfrage Ausstattung Konferenz- Seminar- und Werkräume Übernachtung Verpflegung Zertifizierung Freizeit und Umgebung Preise und Ermäßigungen Kontakt und AnreiseSeminaranmeldung Anreise per Bahn Anreise per PKW Home Aktuelles AkademieBundesweite Fort- und Weiterbildungseinrichtung LJAFÖJ-Rheinland-Pfalz LVHSFördervereinSorgentelefon Geschäftsstelle EDL Rheinland Evangelischer Dienst auf dem Lande in der EKD EDL International Rural Churches Association Europe IRCA Kirche im ländlichen Raum Unser Team Interessante Links ProgrammÄsthetische und kulturelle Bildung Jugendarbeit Jugendpolitische Bildung Kirche sein Gemeinde leben Leiten beraten Seel ebar sidebar-content solid eaeaea padding-bottom sidebar sidebar-content color images-container img albums post img media post img portfolio post img blog post img single post rollover img dt-blog-shortcode img dt-albums-shortcode img dt-portfolio-shortcode img wf-container iso-grid img wf-container layout-masonry img Team Fotos abrunden wpb wrapper ult-just-icon-wrapper img !important Kalender ai1ec-allday-badge display none !important ai1ec-date ai1ec-agenda-view ai1ec-date none !important display none !important ai1ec-month ai1ec-agenda-view ai1ec-month none repeat color fff !important ai1ec-stream-view !important News Detailseite Beitragsbild single post rollover img dt-single-mfp-popup !important Seminarseite Beitragsbild ai1ec rollover img Seminarseite Tabelle content tbody fafafa !important content tbody hover EAEAEA !important content first-child none !important content solid d7d7d7 !important solid d7d7d7 !important solid d7d7d7 !important Veranstaltungen ai1ec-cost display none Formular Eingabe Fokus Textfarbe input type text focus input type tel focus input type url focus input type email focus input type number focus input type date focus input type range focus input type password focus textarea focus color !important Social Buttons social share privacy padding-top Pagination grid-pagination grid-pagination-list grid-pagination-color-blue grid-pagination grid-pagination-list grid-pagination-color-blue span !important grid-pagination padding-bottom Footer font-size f
Arbeit Beruf Karriere Familie Bildung Wissenschaft Umwelt Natur Persönliche Seiten Haus Heim Garten Nach Raum Ort Internet Kommunikation TOP Listen Kfz Verkehr Verschiedenes öffentlich Bus Bahn Allgemeine Infos Kunst Antiquitäten Kultur Direkt vom Künstler Landwirtschaft Technik Agrochemie Aquakultur Astronomie Bauernhöfe Bio Biotechnologie Energietechnik Erdbeben Forschung Entwicklung Forstwirtschaft Gartenschauen Gärtnereien Geologie Erde Boden Flüsse Gartenbau Gebirge Berge Gewässer Grünlandwirtschaft Höhlen Holzwaren Landhandel Nationalparks Naturkatastrophen Organisationen Pflanzenwelt Seen Steinmetze Wald Wasser Windenergie Sonstiges Landtechnik Produktionsmittel Tierhaltung Schafe Untersuchungslabors Medien Nachrichten Informationen Thema der Frau Menschen Vereine Communitys Gruppen Treffs Familien Kinder Jugendliche Singles Möbel Wohnen Einrichtung Style Sparen WeltderFrau | | lja.de
Evangelische Landjugendakademie Altenkirchen Telefon 02681 9 51 60 info lja de Dieperzbergweg 13 17 in 57610 Altenkirchen Westerwald | | 1. lja.de PR-Navi.de
2. lja.de PR-Navi.de

| | ljn.de | | Sex xXx fick Erotik sexy hardcore | Internet Kommunikation TOP Listen |
xt gplus mit verbunden perma option display name referrer txt info Klicks für mehr Erst wenn Sie hier klicken wird der Button aktiv und Sie können Ihre Empfehlung senden Schon beim Aktivieren werden Daten Dritte übertragen EUR siehe language info link www heise dectartikel2-Klicks-fuer-mehr-Datenschutz-1333879 html txt help Wenn Sie diese Felder durch einen Klick aktivieren werden Informationen Facebook Twitter oder die USA übertragen und unter Umständen auch dort gespeichert Näheres erfahren Sie durch einen Klick auf das perma Dauerhaft aktivieren und Datenübertragung zustimmen cookie expires 356 css pat 1 navbar-inner dropdown-toggle click stopPropagation addresses threetwo columns cols isMobile cols span3 address-block each addressblock und cols cols-1 addressblock after span2 address-block each addressblock und addressblock after address-block last-child after overview4col length cols isMobile cols ljn-content csc-default each textpic und cols cols-1 textpic css und cols cols-1 textpic after ready socialshareprivacy length socialSharePrivacy facebook status dummy img facebook png txt off nicht mit Facebook verbunden txt mit Facebook verbunden perma option display name Facebook referrer action recommend chaft Osnabrück-Land Jägerschaft Osnabrück-Stadt Jägerschaft Osterholz Jägerschaft Osterode Jägerschaft Peine Jägerschaft Rotenburg Wümme Jägerschaft Salzgitter Jägerschaft Schaumburg Jägerschaft Seesen Jägerschaft Soltau Jägerschaft Springe Jägerschaft Stade Jägerschaft Syke Jägerschaft Uelzen Jägerschaft Uslar Jägerschaft Vechta Jägerschaft Verden Jägerschaft Wesermarsch Jägerschaft Wesermünde-Bremerhaven Jägerschaft Wittlage Jägerschaft Wittmund Jägerschaft Wolfenbüttel Jägerschaft Wolfsburg Jägerschaft Zeven Stadt DelmenhorstStadt Wilhelmshaven Stellenausschreibungen LJN-Stellenausschreibung Sachbearb txt info Klicks für mehr Erst wenn Sie hier klicken wird der Button aktiv und Sie können Ihre Empfehlung Facebook senden Schon beim Aktivieren werden Daten Dritte übertragen EUR siehe language twitter status dummy img twitter png txt twitter off nicht mit Twitter verbunden txt twitter mit Twitter verbunden perma option display name Twitter referrer txt info Klicks für mehr Erst wenn Sie hier klicken wird der Button aktiv und Sie können Ihre Empfehlung Twitter senden Schon beim Aktivieren werden Daten Dritte übertragen EUR siehe language gplus status dummy img gplus png txt gplus off nicht mit verbunden t exklusiven Hotel Jakobsber Kommunalwahl Niedersachsen Herzensangelegenheit eines Jägers und Anglers News-Archiv DRUCKEN JägerschaftenBesuchen Sie unsere Jägerschaften Internet Suche nach Name Jägerschaft Alfeld Jägerschaft Ammerland Jägerschaft Aschendorf-Hümmling Jägerschaft Aurich Jägerschaft Bersenbrück Jägerschaft Braunschweig Jägerschaft Bremervörde Jägerschaft Burgdorf Jägerschaft Celle Jägerschaft Cloppenburg Jägerschaft der Landeshauptstadt Hannover Jägerschaft der Stadt Oldenburg Jägerschaft Duderstadt Jägerschaft Einbeck Jägerschaft Emden Jägerschaft Fallingbostel Jägerschaft Friesland Wilhelmsh eiter Natur- und Artenschutz DJV-Stellenausschreibung Volontär für das Referat Presse- und Öffentlichkeitsarbeit Jagdzeiten Stand Oktober Jagdzeiten faltbar A6-Format Jagdzeiten A4-Format Über unsAktuellesUnser RevierMitglied werdenFür unsere JägerNewsletterNewsarchivKontaktImpressumWild und JagdJagdhundewesenJagdhornblasenJagdliches SchießenIhr Weg zum NiedersachsenNatur- und ArtenschutzJägerschaftenListe aller JägerschaftenSuche über NiedersachsenkarteSuche nach und CDsWarenkorbVersandkostenAGB Landesjägerschaft Niedersachsen Schopenhauerstr Hannover Tel E-Mail info ljn ie8orworse ready rollover for nav en Sie uns auf Facebook wildtiermanagement com News Niedersächsische Landesforsten führen Schießnachweis ein Schießnachweis wird Voraussetzung für Jagdteilnahme den Landesforsten Treffen der Inseljägerschaften mit Nationalpark- und Domänenverwaltung Inseljägerschaften fordern keine weiteren Einschränkungen der Jagdpachten Nationalpark Nds Wattenmeer DJV-Bundesmeisterschaften Jagdlichen Schießen Claus Schäfer zum zweiten Mal BundesmeisterAlle Ergebnisse Gemeinsam Jagd erleben Abenteuer gewinnen Wild grillen Jagdkunst-Ausstellung Hörnerklang Schießtraining und Ansitz Jetzt bewerben für einen besonderen Tag News Startseite - Landesjägerschaft Niedersachsen redirection mobile url ljn keep path true keep query true isMobile Suche StartseiteÜber unsAktuellesUnser RevierMitglied werdenFür unsere JägerNewsletterNewsarchivKontaktImpressumWild und JagdJagdhundewesenJagdhornblasenJagdliches SchießenIhr Weg zum NiedersachsenNatur- und ArtenschutzJägerschaftenListe aller JägerschaftenSuche über NiedersachsenkarteSuche nach und CDsWarenkorbVersandkostenAGBKontaktImpressum NiedersachsenHerzlich willkommen bei der Landesjägerschaft Niedersachsen dem Landesverband der Jägerinnen und Jäger NiedersachsenNatur- und Artenschu aven Jägerschaft Gandersheim-Altes Amt Jägerschaft Gifhorn Jägerschaft Goslar Jägerschaft Göttingen Jägerschaft Grafschaft Bentheim Jägerschaft Grafschaft Diepholz Jägerschaft Hameln-Pyrmont Jägerschaft Hannover-Land Jägerschaft Helmstedt Jägerschaft Hildesheim Jägerschaft Holzminden Jägerschaft Land HadelnCuxhaven Jägerschaft Landkreis Harburg Jägerschaft Leer Jägerschaft Lingen Jägerschaft Lüchow-Dannenberg Jägerschaft Lüneburg Jägerschaft Melle Jägerschaft Meppen Jägerschaft Münden Jägerschaft Neustadt Jägerschaft Nienburg Jägerschaft Norden Jägerschaft Northeim Jägerschaft Oldenburg-Delmenhorst Jägers tzErfahren Sie mehr über die vielfältigen Natur- und Artenschutzmaßnahmen der Jägerinnen und Jäger Ihr Weg zum JagdscheinSie interessieren sich für das EURGrüne AbiturEUR? Wir informieren Sie gern!JagdhundewesenAusgebildete Jagdhunde sind unverzichtbare Begleiter auf der Jagd Wölfe NiedersachsenDie Wölfe kehren nach Niedersachsen zurück Die Landesjägerschaft Niedersachsen ist mit dem wissenschaftlichen Wolfsmonitoring beauftragt und lsaquo und rsaquo Der VerbandUnser RevierUnsere AufgabeJägerlehrhofJunge JägerKontaktHäufig gesuchtDownloadsMitglied werdenFür unsere MitgliederNewsletterRabattaktionen Besuch
1. ljn.de PR-Navi.de
2. PR-Navi.de ljn.de

Sex xXx fick Erotik sexy hardcore
ljr.de | | |

e! suchst eine Juleica-Ausbildung? Schau auf www juleica-ausbildung und nimm Kontakt auf!Kommunalwahl 09 sind Niedersachsen Kommunalwahlen Dazu wird wieder eine große neXTvote-Kampagne geben Erste Infos findet ihr auf www nextvote de! Home Impressum Kontakt Sitemap Druckansicht Landesjugendring Niedersachsen LJR hat eine eigene Geschichte eigene thematische Schwerpunkte sowie eigene Prägungen und entsteht gerade aus dieser Vielfalt auch die Stärke des LJR Das wurde auch beim diesjährigen parlamentarischen Abend des LJR den sogenannten EURfeier-abend-gesp h gedruckt! Zwei neue Broschüren sind absofort erhältlich EURLos geht EUR Jugendgruppe vor Ort Jugendgruppen-Arbeit Aktionsformen und FördermöglichkeitenEUR gibt Basisinformationen zum Aufbau und Arbeit von JugendgruppenEURJugendarbeit und Schule Kooperationsprojekt der Jugendarbei Juleica gehört und wollen die Ausbildung machen Insbesondere junge Menschen mit Migrationsgeschichte wissen oftmals nicht sie eine Juleica-Ausbildung machen können Auf www juleica-ausbildung könnt ihr freie Plätze eintragen und werdet gefundenEUR mobil responsiv und mit Umkreissuch t NiedersachsenEUR informiert Jugendarbeit Ganztagsschulenzum Bestellen und Downloaden unserem Shop Hintergrund LJRIm Landesjugendring Niedersachsen haben sich aktive Jugendorganisationen einer Arbeitsgemeinschaft zusammengeschlossen Dahinter stehen über eigenständige Jugendverbänd cjavascriptslideshowsommerfestMP2014 loswerden jpg uploadstx sofe anerkennung jpg uploadstx fotoshoot jpg uploadstx vcjavascriptslideshowsommerfestdesMP2014 Gruppe jpg cacheImages counter quot counter pictures length window setInterval crossfade vctagid pictures quot Alt-Text Frisc Landesjugendring Niedersachsen 4 browserName Netscape und browserVer msie4browserName Konqueror browserName Opera version blurLink theObject msie4 theObject blur decryptCharcode start end offset und end start n-end-1 offset Passwort vergessen? Wir bewegen Jugendarbeitin Niedersachs e deren Aktivitäten Prozent aller Kinder und Jugendlichen Niedersachsen erreichen Somit ist der Landesjugendring die größte und ihrer Art einzige Interessengemeinschaft für Kinder und Jugendliche Niedersachsen Gastfreundschaft schafft Freunde! fag2016Jeder der Mitgliedsverbände des en! pictures new Array uploadstx vcjavascriptslideshowsommerfestMP2014 schild2 jpg uploadstx ideenexpo2015 jpg uploadstx vcjavascriptslideshowsommerfestMP2014 schirm jpg uploadstx sofe2015 weil jpg uploadstx fotoshoot jpg uploadstx interk jpg uploadstx ideenexpo2015 jpg uploadstx v rächenEUR der Jugendkirche Hannover deutlich Mehr lesenEUR Fotos von den fag2016EUR gibt eurem Jugendverband noch freie Plätze für die Juleica-Ausbildung? Die Jugendleiter-innen-Ausbildung ist die Chance junge Menschen für ein Engagement motivieren! Viele Jugendliche haben von der | | 1. PR-Navi.de ljr.de
2. ljr.de PR-Navi.de


| ljrberlin.de |
Sex xXx fick Erotik sexy hardcore | sstätten und Migrant innenjugendselbstorganisationen mit jungen Geflüchteten aus Mitteln des Landes Berlin EUR Senatsverwaltung für Bildung Jugend und Wissenschaft und der Stiftung Demokratische Jugend Weitere Meldungen Weiterbildung Diversitätsbewusste Jugend verbands arbeit Wie gehen wir mit Vorurteilen unter Ehrenamtlichen um? Wie wird Akzeptanz Verband für die Arbeit mit jungen Geflüchteten geschaffen? Welche Methoden eignen sich besonders mögliche Ressentiments und Barrieren überwinden? Sind unsere Strukturen und Angebote wirklich offen für alle Zielgruppen? Diese Fragen werden der Landesjugendring-Weiterbildung i dules contrib date popup themes datepicker css sites all modules contrib date repeat field date repeat field css modules field theme field css modules node css modules user css sites all modules contrib views css sites all modules contrib ckeditor css sites all modules contrib colorbox default colorbox css sites all modules contrib ctools css sites all modules contrib panels css sites all modules contrib tagclouds css sites all modules contrib panels plugins layouts flexible css public ctools css sites all modules custom w21 sitemap w21 sitemap css sites all themes ljr system menus css sites all themes ljr css normaliz blikationen JugendbildungsstättenU18 DownloadFörderung Selbstorganisation Recht und GesetzFSJ GeschäftsstelleBibliothek JuleicaMitbestimmung GremienJugendverbände RSS Kontakt Impressum Sitemap ausklappenThemenJugendpolitikInterkulturelle ÖffnungSchulkooperationKinderschutzWofür wir stehenSelbstorganisation Mitbestimmung und EhrenamtJugendverbandsarbeitQualitätskriterien der JugendverbandsarbeitJuleicaRabatte HilfeOnline-AntragNachweise und Teilhabepaket BuT Jugendringe paq push piwik werk21system depiwik paq push piwik php paq push setSiteId type textjavascript async true defer true src piwik parentNode insertBefore 0dfen fixed true mobiledetect true Zur Navigation springen Das Junge Wahlprogramm für Berlin Mehr Anerkennung für junges Ehrenamt endlich mehr Geld für Jugendverbände bessere Chancen für junge Geflüchtete und Kinder und Jugendliche die von Armut betroffen oder gefährdet sind Mit neun Forderungen die Berliner Politik geht der Landesjugendring die neue Berliner Legislaturperiode Eine Übersicht gibt das Junge Wahlprogramm für Berlin Weiterlesen JUGEND WÄHLT BERLIN Forderung des Monats September Woran liegt dass Partizipationsangebote von Politiker innen Kinder und Jugendliche Berlin wenig genutzt werden? Politik und Verwa LJR Landesjugendring Berlin e extend Drupal basePath pathPrefix theme ljr theme token a-623-acNgDU0aTCO03vCRPmGdiLy2dsEdd SS1UxTk misc once misc drupal public languages Y8ugQXJlgTm1eiUgg0tNEA38WffkS143Ql9YEVxmLKE sites all libraries colorbox-min sites all modules contrib colorbox sites all modules contrib colorbox default colorbox sites all modules custom w21 sitemap w21 sitemap sites all themes ljr css modules system base css modules system menus css modules system messages css modules system theme css sites all modules contrib simplenews css modules comment css sites all modules contrib date api date css sites all mo e css sites all themes ljr css wireframes css sites all themes ljr css layouts css sites all themes ljr css sites all themes ljr css tabs css sites all themes ljr css pages css sites all themes ljr css blocks css sites all themes ljr css navigation css sites all themes ljr css sites all themes ljr css panels css sites all themes ljr css nodes css sites all themes ljr css comments css sites all themes ljr css forms css sites all themes ljr css fields css sites all themes ljr css print css sites all themes ljr css ckeditor css colorbox opacity current von total previous u00ab Zur u00fcck next Weiter u00bb close Schlie u0 ation Bildung Integration Landesjugendring einem Projekt zur Interkulturellen Öffnung der Jugendverbandsarbeit Berlin Die jetzt erschienene Projektdokumentation gibt einen Einblick die wichtigsten Inhalte des Projekts und formuliert abschließend Gelingensfaktoren die Prozesse der Interkulturellen Öffnung unterstützen können Weiterlesen Alle Meldungen anzeigen ThemenJugendpolitikJugendarbeit JUGEND WÄHLT BERLIN Interkulturelle Berlin Jugendmigrationsbeirat Berlin Jung geflüchtet selbstbestimmt SchulkooperationKooperationsangebote Rahmenvereinbarung Freiwilliges Soziales Jahr FSJ Kinderschutz Wofür wir stehenSelbstorgani ltung müssen versuchen die Sprache der Jugendlichen besser verstehen statt Angebote ihrer eigenen Sprache machen Jugendverbände können bei der EURÜbersetzungEUR eine wichtige Rolle spielen Weiterlesen LJR Berlin sucht Fachreferent für Jugendverbandsarbeit Der Landesjugendring Berlin sucht zum November eine Fachreferent für Jugendverbandsarbeit Elternzeitvertretung Bewerben kann man sich bis September Weiterlesen Empfehlung Förderung von Angeboten für junge Geflüchtete der Jugendverbandsarbeit Jung Geflüchtet Selbstbestimmt Der Landesjugendring Berlin fördert weiterhin Angebote von Berliner Jugendverbänden Jugendbildung sation Mitbestimmung und Ehrenamt Jugendverbandsarbeit Qualitätskriterien der Jugendverbandsarbeit JuleicaRabatte geben Vergünstigungen Sonderurlaub Ausbildung Methoden Erste Hilfe Online-Antrag Nachweise und Zertifikate FörderungZentralstelle Förderprogramme Bildungs- und Teilhabepaket BuT LandesjugendringMitglieder Gremien Satzung Jugendbildungsstätten Geschäftsstelle Projekte Andere Jugendringe Newsletter Publikationen Download Recht und Gesetz Material und Tipps Stellenausschreibungen RSS-Feed Suche Termine PressePressemitteilungen Selbstdarstellung Archiv Intern Kontakt Impressum Suchformular Suche Link EhrenamtPu nterkultureller Kompetenz und interkulturelle Öffnung behandelt Weiterlesen Weiterbildung Haftungs- und Versicherungsfragen der Jugendarbeit Aufsichtspflicht Jugendschutz Haftpflicht den Mitarbeiter innen Sicherheit der Thematik EURHaftungs- und Versicherungsfragen der JugendarbeitEUR geben können veranstalten die Landesjugendringe Berlin und Brandenburg gemeinsam eine Weiterbildung der man sich noch bis September anmelden kann Weiterlesen Interkulturelle Öffnung der Jugendverbandsarbeit Berlin Projektdokumentation EURPartizipation Bildung IntegrationEUR erschienen Nach dreijähriger Laufzeit endete das Projekt Partizip | Bildung Wissenschaft Archäologie Organisationen Biologie Chemie Geistesw Geologie Informatik Mathematik Medizin Physik Psychologie Weitere Wissensgebiete Sprachen Übersetzungen Dolmetscher Nach online Versicherungen Rente Vorsorge Leben | Der Landesjugendring Berlin ist der Zusammenschluss der Jugendverb nde im Land Berlin Der Landesjugendring Berlin setzt sich ein f r die Verwirklichung des Rechts Jugendlicher auf gesellschaftliche Teilhabe in der demokratischen Gesellschaft | 1. ljrberlin.de PR-Navi.de
2. PR-Navi.de ljrberlin.de

| Sex xXx fick Erotik sexy hardcore | Landesjugendring Brandenburg
026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt die Jugendverbandsarbeit die Zukunft der nau u0026amp szlig erschulischen Bildung u0026amp uuml alle Kinder und Jugendlicher darstellt u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt u0026lt u0026gt nAndrea nBund nder deutschen katholischen Jugend u0026lt span u0026gt Title Andrea Köhler Mode ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt ich Spa u0026amp szlig daran habe mit und u0026amp uuml nJugendliche arbeiten und mich engagieren u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt u0026lt u0026gt nGeorg Bund nder deutschen katholischen Jugend u0026lt span u0026gt Ti dex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt ich gerne neue Leute nkennenlerne mich einbringen u0026amp ouml chte und Jugendlichen Freude bereiten u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt David Evangelische Jugend u0026lt span u0026gt Title David Lorenz Mode ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt ich etwas bewegen u0026amp ouml chte nund anderen Menschen helfen will u0026lt span u0026gt u0026lt strong u0026gt u0026lt strong u0026gt u0026lt span u0026quot Normal u0026quot u0026gt Marcel Landesjugendfeuerwehr Brand -referent-innen Schön dass Sie vorbeischauen! Herzlich willkommen auf den Seiten des Referent innenpools der Landesjugendringe Brandenburg und Berlin! Jugendverbandsarbeit lebt von lebendigen Formaten und der kompetenten Aufbereitung von Inhalten und Informationen für Kinder und Jugendliche Hier und bdquo Pool und ldquo haben Referent innen mit einschlägiger Erfahrung der Jugendverbandsarbeit die Möglichkeit ihr Profil hochzuladen Mitarbeiter innen der Jugendverbände können und bdquo Pool und ldquo einfach und unkompliziert Referent innen Fachthemen und Schlagworten finden und ndash egal Supervision Kinderrechten Spielraumer-öffnung oder Organisationsentwicklung Und das Beste ist der ist sowohl für Referent innen als auch für die Jugendverbände kostenfrei Damit der und bdquo Pool und ldquo für alle Beteiligten Sinn macht sind wir auf Mithilfe ang ewiesen Sollten Sie gute Referent innen kennen freuen wir uns auf Empfehlungen Vielleicht vertreten Sie auch selbst kompetent ein Fachtthema? Dann übermitteln Sie uns bitte ihr Profil Nach der redaktionellen Freigabe durch unsere Geschäftsstellen können interessierte Nutzer auf ihr Profil greifen Fortbildungen für Haupt- und Ehrenamtliche der Jugendverbandsarbeit Fortbildungsangebote der Landesjugendringe Berlin und Brandenburg Alle Veranstaltungen März können hier eingesehen werden Julia und Dennis Zum Vergrößern klickt einfach auf das Comic! Ich engagiere mich ehrenamtlich weil macht Spaß Tim Landesjugendfeuerwehr Brandenburg wir den Jugendlichen zeigen wollen dass mehr gibt als Fernsehen und Internet Maik Brandenburgische Landjugend die Jugendverbandsarbeit die Zukunft der außerschulischen Bildung für alle Kinder und Jugendlicher darstellt And rea Bund der deutschen katholischen Jugend ich Spaß daran habe mit und für Jugendliche arbeiten und mich engagieren Georg Bund der deutschen katholischen Jugend ohne zum absoluten Chaos käme! Gerd Landesjugendfeuerwehr Brandenburg Spaß macht Menschen helfen Maik Landesjugendfeuerwehr Brandenburg ich gerne neue Leute kennenlerne mich einbringen möchte und Jugendlichen Freude bereiten David Evangelische Jugend ich etwas bewegen möchte und anderen Menschen helfen will Marcel Landesjugendfeuerwehr Brandenburg ich mich unter anderem als aktiver Mitgestalter meiner und unserer Umwelt verstehe Christoph Landesjugendwerk der Arbeiterwohlfahrt Brandenburg function ready function options869 moduleId effect fade speed timeout items ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026qu Landesjugendring Brandenburg LJR Brandenburg Suchen previousSelection previousSelectionNormal function selectmenuitem which toggle true previousSelection null previousSelection previousSelectionNormal which previousSelection which previousSelectionNormal window status true LJR Brandenburg Home Der Landesjugendring Fachstelle Juleica Mitgliedsverbände ThemenSchwerpunkte Jugendpolitik Förderung PresseNewsletter Kontakt Hier geht den Freiwilligendiensten Hier geht zum Zeitwerk Hier geht zur Juleica Herzlich Willkommen Das ist der Landesjugendring Brandenburg Wir bringen Jugend die Politik! mit der jugendpolitischen Interessenvertretung Wir fördern Ehrenamt! mit der Jugendleiterinnencard Wir reden mit! für die Partizipation von Kindern und Jugendlichen Brandenburg Wir machen schlau! mit Bildungsarbeit für Jugendliche Wir sind für Demokratie! mit unse enburg u0026lt span u0026gt Title Marcel Burkhart Mode ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt ich mich unter anderem als naktiver Mitgestalter meiner und unserer Umwelt verstehe u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt u0026lt u0026gt nChristoph Landesjugendwerk der Arbeiterwohlfahrt Brandenburg u0026lt span u0026gt Title Christoph Götz Mode startRotating isClick rotateContent options869 Veranstaltungen Fortbildungsreihe Alles Gepäck Erweiterung des Methodenkoffers der Jugendarbeit Jugendleiterinnen-Ausbildung Teil JuleiCa Schulung Jugendleiterinnen-Ausbildung Teil II JUGENDWARTEKONGRESS DER BRANDENBURGISCHEN SPORTJUGEND LJR Brandenburg Impressum Anmelden ot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt macht Spa u0026amp szlig u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt u0026lt u0026gt nTim Landesjugendfeuerwehr Brandenburg u0026lt span u0026gt u0026lt u0026gt Title Tim Jakob Mode ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt wir den Jugendlichen nzeigen wollen dass mehr gibt als Fernsehen und Internet u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt u0026lt u0026gt nMaik Brandenburgische Landjugend u0026lt span u0026gt Title Maik Hollubetz Mode ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0 tle Georg Ermer Mode ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt ohne zum absoluten Chaos u0026amp auml me! u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt u0026lt u0026gt nGerd Landesjugendfeuerwehr Brandenburg u0026lt span u0026gt Title Gerd Rademacher Mode ModuleId OrderIndex Content u0026lt img alt u0026quot src u0026quot Portals0SitePicsLJRWechselmodulLJR Wechselmodul jpg u0026quot u0026gt u0026lt span u0026quot NormalBold u0026quot u0026gt u0026lt u0026gt Spa u0026amp szlig macht Menschen helfen u0026lt span u0026gt u0026lt span u0026quot Normal u0026quot u0026gt Maik Landesjugendfeuerwehr Brandenburg u0026lt span u0026gt Title Maik Berger Mode ModuleId OrderIn rem Engagement für Toleranz gegen Rechtsextremismus und Fremdenfeindlichkeit Wir sind Partner! der Kooperation von Schule und Jugendarbeit Wir entwickeln weiter! mit der Qualitätsentwicklung und Qualitätssicherung durch ein Kompetenzteam Aktuelles der Ausschreibung für unseren Förderfonds findet ihr weitere Informationen Die gültige Förderrichtlinie gibt Hinweis den Förderbereichen Fördervoraussetzungen etc einen Förderantrag stellen nutzt bitte das Formular Der Förderantrag kann per Post oder Email uns geschickt werden Für Eure Fragen steht Euch Lisa Müntz Dienstag von Uhr und Donnerstag von Uhr außer Donnerstag von Uhr telefonisch oder per Email initiativfonds ljr-brandenburg gern zur Verfügung EUR Referent innen Pool der Fachstelle Juleica Der Referent innen Pool welcher auf dem Fachtag vorgestellt wurde ist nun endlich verfügbar! www pool-der
ljr-brandenburg.de

|
1. PR-Navi.de ljr-brandenburg.de
2. PR-Navi.de ljr-brandenburg.de

sex
| ljrmv.de |
Sex xXx fick Erotik sexy hardcore |
Ofizielle Website des Landesjugendrings Mecklenburg Vorpommern e V LJRMV
Landesjugendring Mecklenburg-Vorpommern - Startseite wNavidStandard wNoNavpoint wProjectPath ljrmv hdLimitDpr lightboxType wLightbox Suchbegriff AktuellesAktuelle MeldungenLJR und bundesweitAus den VerbändenInfos AboNewsletter Infomail M-VNewsletter-ArchivAktuelle ProjekteFlucht und JugendLandtagswahl mit Fokus JugendpolitikFerienkalenderVeranstaltungenDer LJR IdeeDie AngeboteAktuellesDas TeamEmpfehlenswerte MedienJugend PlatformEurop Freiwilligendienst EFDTake Five for EuropeJugendkonferenz und InformationenWebfeature zur JuleicaJuleica - Infos und LJR M-VMedienscouts MVMedienkompetenzportal MVEnglishAt GlancePlatform NetworkInternationalTake Five for Europe Landesjugen dring Mecklenburg-Vorpommern Jugendpolitische Forderungen zur Landtagswahl Mecklenburg-Vorpommern Schöne Ferien für alle Kinder und Jugendlichen Mecklenburg-Vorpommern Blogeintrag unseres Geschäftsführers Friedhelm Heibrock Mitgliedsverbände Landesjugendring EUR wählt! Informationen für Jugendliche und ihre Unterstützer innen zur Landtagswahl Mecklenburg-Vorpommern Jugend Landtag Ergebnisse und Eindrücke der landesweiten Kooperation von Landesjugendring und Landtag zur Jugendbeteiligung Landesjugendring MVMecklenburg-Vorpommern1Jugendpolitische Forderungenzur Landtagswahl Mecklenburg-Vorpommern2Schöne Ferien für alle Kinder und Jugendlichen Mecklenburg-VorpommernBlogeint alle Kinder und Jugendlichen Mecklenburg-Vorpommern Blogeintrag unseres Geschäftsführers Friedhelm Heibrock Jugendpolitische Forderungenzur Landtagswahl Mecklenburg-Vorpommern1Landesjugendring MVMecklenburg-Vorpommern2Mitgliedsverbändeim Landesjugendring MV304 EUR wählt!Informationen für Jugendliche und ihre Unterstützer innen zur Landtagswahl Mecklenburg-Vorpommern Landtag und Eindrücke der landesweiten Kooperation von Landesjugendring und Landtag zur Jugendbeteiligung Ferien für alle Kinder und Jugendlichen Mecklenburg-VorpommernBlogeintrag unseres Geschäftsführers Friedhelm Heibrock Der Landesjugendring M-V Landesjugendring Mecklenburg-Vorpommern haben sich Landesjug jQuery this parent find img pictureDefault attr width width width jQuery this parent width else width String width px width ! jQuery this css max-width width jQuery this css width 64 Medienpolitische Forderungen zur Landtagswahl MVjQuery i d2af182814ecd84bcde42115a55e3b34 load window setTimeout jQuery d2af182814ecd84bcde42115a55e3b34 find pictureSubtitle each width jQuery this parent find img pictureDefault attr width width width jQuery this parent width else width String width px width ! jQuery this css max-width width jQuery this css width 64 BeteiligungswerkstattjQuery i 32db9e3b904efe58d4b2171e3748a40e load window setTimeout jQuery 32db9e3b904efe58d4b2171e3748a40e fi xfbml parentNode insertBefore type async true src apis parentNode insertBefore activateTweet tweetElement href twitter comshare tweetElement twitter-share-button tweetElement data-count horizontal tweetElement data-lang tweetElement Tweet tweetDiv tweet-div tweetDiv appendChild tweetElement type async true src platform twitter firstElement parentNode insertBefore firstElement Tweets von ljrmv test location ? https !d id src platform twitter parentNode insertBefore twitter-wjs Aktuelle Infos news ljrmv dejQuery i 6e899903827933e0b18e0f707071234e load window setTimeout jQuery 6e899903827933e0b18e0f707071234e find pictureSubtitle each width jQuery this parent find img pict nd pictureSubtitle each width jQuery this parent find img pictureDefault attr width width width jQuery this parent width else width String width px width ! jQuery this css max-width width jQuery this css width 64 Aktuelle Nachrichten Facebook-Seite Twitter-Seite Newsletter abonnieren 49 385 76076-0info ljrmv deLandesjugendring M-V e V Goethestraße 7319053 Schwerin zum Kontaktformular StartseiteInhaltImpressumDatenschutzDruckansicht Unbenanntes Dokument i o g r m i GoogleAnalyticsObject r i r i r i r q i r q push arguments i r l new Date o m o a async a src g m parentNode insertBefore m window www google-analytics comanalytics ga ga create UA-59956874-1 auto ga send pagev ureDefault attr width width width jQuery this parent width else width String width px width ! jQuery this css max-width width jQuery this css width 64 10 Jugend Landtag JiL16jQuery i f82218bd01fba7138d559ea8270175ed load window setTimeout jQuery f82218bd01fba7138d559ea8270175ed find pictureSubtitle each width jQuery this parent find img pictureDefault attr width width width jQuery this parent width else width String width px width ! jQuery this css max-width width jQuery this css width 64 Jugendpolitische Forderungen zur Landtagswahl MVjQuery i f838a9b3e8721f2c347aabc3f410f2b2 load window setTimeout jQuery f838a9b3e8721f2c347aabc3f410f2b2 find pictureSubtitle each width rag unseres Geschäftsführers Friedhelm Heibrock Landesjugendring MV404 EUR wählt!Informationen für Jugendliche und ihre Unterstützer innen zur Landtagswahl Mecklenburg-Vorpommern Landtag und Eindrücke der landesweiten Kooperation von Landesjugendring und Landtag zur Jugendbeteiligung Jugendpolitische Forderungen zur Landtagswahl Mecklenburg-Vorpommern Landesjugendring Mecklenburg-Vorpommern Mitgliedsverbände Landesjugendring EUR wählt! Informationen für Jugendliche und ihre Unterstützer innen zur Landtagswahl Mecklenburg-Vorpommern Jugend Landtag Ergebnisse und Eindrücke der landesweiten Kooperation von Landesjugendring und Landtag zur Jugendbeteiligung Schöne Ferien für mit dem demografischen Wandel auseinander und suchen Handlungsansätze und -vorschläge was geändert werden kannmuss Jugendregierungsprogramm der Teilnehmenden bei Jugend Landtag Land gewinnen EURTake EUR Welcome Europe!EUR Norddeutsche Jugendkonferenz vom bis April mit Jugendlichen aus Bremen Hamburg Mecklenburg-Vorpommern Niedersachsen und Schleswig-Holstein Wissensvermittlung auf Augenhöhe Achte Generation Medienscouts ausgebildet EURSchau hin EUR Kinderarmut geht uns alle an!EUR Landesweites Netzwerk gegen Kinderarmut gibt Hilfestellung für Betroffene weiteren aktuellen Meldungen des LJRMV activateFbLike c2076b139102a08c401ac2d76f719011 src connect facebook netde DEall endverbände Anschlussverbände und Jugendringe einer Arbeitsgemeinschaft zusammengeschlossen Aktuelles Mehr Medienbildung für alle Generationen Medienpolitische Forderungen von Medienaktiv M-V zeigen Wirkung Nicht egal! Initiative EURWIR Erfolg braucht VielfaltEUR startet Kampagne für Politik und Debattenkultur Internet Zielgruppe der Kampagne sind junge Menschen Alter von Jahren EUR Kontroverse Debatten sind ausdrücklich erwünscht Rechtspopulisten keine Bühne bieten Landesjugendring gegen Rechtspopulismus EUR Hauptausschuss beschließt Rechtspopulisten keine Bühne bieten Jetzt anmelden Demografie-Werkstatt Tribsees Jugendbeteiligung vor Ort Jugendliche Jahren setzen sich
1. ljrmv.de PR-Navi.de
2. PR-Navi.de ljrmv.de

IndexMetaDescriptionStandard
Sparen
tle Topseller headline true scrollSpeed 1 500 rotateSpeed 1 5000 rotate false layout horizontal showNumbers false navigation false showArrows true scrollWidth 1 1010 scrollHeight 1 545 skipInitalRendering true maxPages 1 4 extraParams category 1 3 start limit 1 4 elementWidth 1 1010 elementHeight 1 504 max 1 12 slider slider article 05a5cf06982ba7892ed2a6d38fe832d6 ajaxSlider ajax config slider find sliding outer sliding container css height 509 slider find aja on-element-0-11 width 1020px height 555px left 0px top 1480px emotion-inner-element-0-11 width 1010px height 545px Telefonischer Kontakt Telefonische Unterstützung und Beratung unter 0711 26 84 36-17 Shop Service AGB Widerrufsrecht Versand und Zahlungsbedingungen Batterieverordnung Informationen Über uns Datenschutz Impressum Alle Preise inkl gesetzl Mehrwertsteuer zzgl Versandkosten und ggf Nachnahmegebühren wenn nicht anders beschrieben - Alle Rechte vorbehal id if ref url und referer encodeURI ref url replace https url replace http url und x-shopware-nocache new Date getTime ajax url dataType jsonp Um LJV Jagd-Service in vollem Umfang nutzen zu können empfehlen wir Ihnen Javascript in Ihrem Browser zu aktiveren LJV Jagd-Service Mein Konto Warenkorb 00 und euro Home Bücher und Medien Ausrüstung Bekleidung Lernort Natur Küche und Genuss Naturschutz Mein Verband ready config title headline true navigation false scroll Speed 1 1500 rotateSpeed 1 8000 rotate true layout horizontal showNumbers true navigation true showArrows true scrollWidth 1 1020 scrollHeight 1 360 slider slider banner c8758b517083196f05ac29810b924aca ajaxSlider locale config slider find sliding outer sliding container css height 324 slider find ajaxSlider css height 360 Bücher und Broschüren und BücherPoster und TafelnCD s und DVD s Ausrüstung und Zubehör Werkzeuge und MesserLampenZubehör Bekleidung HerrenDa config slider find sliding outer sliding container css height 509 slider find ajaxSlider css height 543 emotion-element-0-0 width 1020px height 370px left 0px top 0px emotion-inner-element-0-0 width 1010px height 360px emotion-element-0-1 width 340px height 370px left 0px top 370px emotion-inner-element-0-1 width 330px height 360px emotion-element-0-2 width 340px height 370px left 340px top 370px emotion-inner-element-0-2 width 330px height 360px emotion-eleme xSlider css height 543 function ready config url widgetsemotionemotionTopSeller title Topseller headline true scrollSpeed 1 500 rotateSpeed 1 5000 rotate false layout horizontal showNumbers false navigation false showArrows true scrollWidth 1 1010 scrollHeight 1 545 skipInitalRendering true maxPages 1 4 extraParams category 1 3 start limit 1 4 elementWidth 1 1010 elementHeight 1 504 max 1 12 slider slider article 3a824154b16ed7dab899bf000b80eeee ajaxSlider ajax menKinder Lernort Natur Lernen und LehrenSpielen Malen und EntdeckenLeNa Zubehör Küche und Genuss KücheGenussBücher und Broschüren Naturschutz Wildtier-Informationen Poster und Tafeln Zubehör Mein Verband Urkunden und FormulareNadeln Broschüren Rabatte Hier finden Sie alle Informationen zu unseren Mitgliederrabatten z B zum A T U Rabatt Aktuelle Angebote Alle aktuelle Angebote finden Sie hier Aktuelle Angebote! ready config url widgetsemotionemotionTopSeller ti LJV Jagd-Service ready cok cookie match session-1 sid cok und cok ? cok null par location search match sPartner und pid par und par ? par substring 9 null cur location protocol location host ref referrer indexOf cur -1 ? referrer null url http www ljv-jagdservice dewidgetsindexrefreshStatistic pth location pathname replace url indexOf ? -1 ? ? und url requestPage encodeURI pth url und requestController encodeURI index if sid url und sid if pid url und partner p nt-0-3 width 340px height 370px left 680px top 370px emotion-inner-element-0-3 width 330px height 360px emotion-element-0-4 width 340px height 370px left 0px top 740px emotion-inner-element-0-4 width 330px height 360px emotion-element-0-5 width 340px height 370px left 340px top 740px emotion-inner-element-0-5 width 330px height 360px emotion-element-0-6 width 340px height 370px left 680px top 740px emotion-inner-element-0-6 width 330px height 360px emotion-elem ent-0-7 width 340px height 370px left 0px top 1110px emotion-inner-element-0-7 width 330px height 360px emotion-element-0-8 width 340px height 370px left 340px top 1110px emotion-inner-element-0-8 width 330px height 360px emotion-element-0-9 width 340px height 370px left 680px top 1110px emotion-inner-element-0-9 width 330px height 360px emotion-element-0-10 width 1020px height 555px left 0px top 1480px emotion-inner-element-0-10 width 1010px height 545px emoti | |
ljv-jagdservice.de
Sex xXx fick Erotik sexy hardcore |
1. ljv-jagdservice.de PR-Navi.de
2. ljv-jagdservice.de PR-Navi.de

viele talentierte MusikerInnen anzuhören Wir gratulieren den neuen Mitgliedern LJJO Hamburg Vincent Dombrowski Lisa Buchholz Ken Dombrowski Moritz Hamm Mehr anzeigenLandesjugendjazzorchester Hamburg hier Hochschule für Musik und Theater Hamburg Juli Gleich beginnen die Vorspiele für LJJO Hamburg Die Begleitband spielt sich schon warm Wir freuen auf viele talentierte Bewerberinnen und Bewerber! Landesjugendjazzorchester Hamburg hat seinihr Foto geteilt EUR sehr dankbar Juli Shanghai Volksrepublik China Genau zwei Jahre liegt unsere Tour nach China nun zurück Wundervolle Erinnerungen Unter anderem diese Konzert vor knapp chinesischen StudentInnnen Shanghai die bei jedem Solo jedem Tutti jedem hohen Ton jedem Schlagzeug-Fill völlig ausgerastet sind Rockstar-Feeling! DLandesjugendjazzorchester Hamburg23 Juni noch ein Grund mehr Jazzradio Berlin hören Der Titel Sir Charle Teatime Komp Torsten Maaß unserer aktuellen läuft Programm JazzEuropa JazzRadio net JazzDa Berliner JazzRadio spielt Seiten Jazz Die Einflüsse reichen von Latin Soul und Smooth über Swing Electronic radio Einfach Radio hörenjazzradioberlin radio deLandesjugendjazzorchester Hamburg20 Juni zum können sich noch Gitarristen Tenorposaunisten Altsaxophonisten Trompeter Bassisten und Schlagzeuger für eine Teilnahme LJJO bewerben Weitere Detail erfahrt ihr hier www landesmusikrat-hamburg deEUR Ausschreibung LJJO HEUR Wir freuen auf eure Bewerbungen!Landesjugendjazzorchester Hamburg14 Juni Taddaa heute erscheint unsere neue CD!!! Unter dem Titel EURNEW SOUND EUR Bigbandkomponisten DeutschlandEUR stellen wir einige herausragende Komponisten und Arrangeure vor und zeigen die große Spannbreite der Bigbandmusik Deutschland auf Wer die käuflich erwerben möchte schickt gerne eine E-Mail mit dem Betreff NEW SOUND conrad landesmusikrat-hamburg Landesjugendjazzorchester Hamburg hat einen Beitrag geteilt Juni Wow unsere New Sound erscheint nächste Woche und hat jetzt schon einen Prei für den Sound gewonnen Herzlichen Glückwunsch Made Indrayana für die Auszeichnung und vielen Dank für die schöne Zeit Studio der HAW Hamburg!Made Indrayana hier Palai congr Pari Juni Pari Ile-de-France Frankreich SILVER AWARD!! Special thank Benjamin Gallagher bro who did lot with thi recording Malte Hildebrandt Maryam Ronia Hanne Sapateiro for helping hand the recording Lar Seniuk and Landesjugendjazzorchester Hamburg for the beautiful music Very special thank Thoma Görne Carsten Goldberg Tonlabor HAW Hamburg for making thi possible Mehr anzeigenLandesjugendjazzorchester Hamburg18 Mai Zum Herbst werden wieder Plätze frei LJJO Hamburg Und zwar für Gitarre Tenorposaune Altsaxophon Trompete Bas und Schlagzeug wann und wie ihr euch bewerben könnt erfahrt ihr hier www landesmusikrat-hamburg deEUR Ausschreibung LJJO HEUR Wir freuen auf eure Bewerbungen!!!Landesjugendjazzorchester Hamburg hier Cascada Hamburg Wow hat Power! Partyka That und Opener live der Cascada Bar Ein Video von unserem Abschlusskonzert der letzten Arbeitsphase Thema der Frühjahrsarbeitsphase waren die Kompositionen von Steve Gray und Partyka für tolle Musik! youtu beCD7CI3XKfiQThat und Opener Landesjugendjazzorchester HamburgDa Landesjugendjazzorchester Hamburg spielt Partyka Komposition That und Opener unter der Leitung von Lar Seniuk der Cascada Bar youtube comLandesjugendjazzorchester Hamburg8 April Morgen ist soweit vorerst letzte Konzert mit unserem aktuellen Programm Between Light and Darknes the music Steve Gray and Partyka Hamburg Wir freuen auf zahlreiche Gäste Samstag April Uhr Atrium der Hanse-Merkur-Versicherung Warburgstr Hamburg Eintritt der AbendkasseMehr anzeigenDa Landesjugendjazzorchester Hamburg vereint und fördert die talentiertesten und ambitioniertesten Jazzmusiker der Hansestadt Jahre Personen gefällt dasInfoAlle anzeigenAntwortet normalerweise innerhalb von ein paar StundenJetzt eine Nachricht sendenwww landesmusikrat-hamburg deDeutsch English Türke Espaol Portugu Brasil Werbung Cookie Mehr Facebook require handle instance inst elem true inst Menu MenuItem markup XUIMenuWithSquareCorner XUIMenuTheme href about title accesskey ctor MenuItem markup label u00dcber null href www facebook com career ?ref title accesskey null ctor MenuItem markup label Karriere null href www facebook com page create ?ref type site footer title accesskey null ctor MenuItem markup label Seite erstellen null href developer facebook com ?ref title accesskey null ctor MenuItem markup label Entwickler null href www facebook com help ?ref title accesskey ctor MenuItem markup label Hilfe null behavior XUIMenuWithSquareCorner theme XUIMenuTheme inst e5ad243d PopoverMenu inst elem e37e2711 inst elem e37e2711 inst Popover elem e37e2711 ContextualLayerAutoFlip elem e37e2711 ContextualLayerAutoFlip alignh right position below inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst DataSource maxResult queryData group message last comment time neighbor membership group set subtext true queryEndpoint typeahead group mention bootstrapData group message last comment time neighbor membership group set subtext true bootstrapEndpoint typeahead group mention bootstrap enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch token inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention photo fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention photo fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only inst MultiBootstrapDataSource maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only markup d3c2dfe2 html Geteilt mit u00d6ffentlich markup html u003Cdiv u003Ca href www facebook com photo php?fbid und set und type rel theater www facebook com photo php?fbid und set und type und size u00252C720 und source und player origin page data-testid ufi comment photo u003Cdiv u003Cimg img src scontent-fra3-1 fbcdn net s261x260 jpg?oh und left top alt Gerhard Lein Foto u003C div markup a0d94362 html u003Cdiv uiScaledImageContainer u003Cimg img src scontent-fra3-1 fbcdn net s110x80 jpg?oh cda0dd3fefde344ce7b40236ac6c9e78 und alt Gerhard Lein Foto u003C div markup d3c2dfe2 html Geteilt mit u00d6ffentlich markup html u00dcber markup html Karriere markup html Seite erstellen markup html Entwickler markup html Hilfe element elem b307cb32 elem login form elem loginbutton elem f46f4946 elem f46f4946 elem login form elem a6f65671 pagelet bluebar elem a588f507 globalContainer elem a588f507 elem a588f507 elem b8b0125f elem www page reaction see more unit elem a588f507 elem a588f507 elem a588f507 elem a588f507 elem a588f507 elem a588f507 elem a588f507 elem e980dec4 elem a588f507 elem a588f507 elem a588f507 elem e980dec4 elem a588f507 elem a588f507 elem a588f507 elem e980dec4 elem rhc footer selector elem e37e2711 require CurrentPage init pageID pageName Landesjugendjazzorchester Hamburg HubbleLogger setActiveSurface HubbleLogger setPlatform www Landesjugendjazzorchester Hamburg set XPagesProfileHomeController f9058300 imp da48ce98 entity UITinyViewportAction init elem a588f507 elem a588f507 AccessibilityWebVirtualCursorClickLogger init elem a6f65671 elem a588f507 elem a6f65671 elem a588f507 WebStorageMonster schedule BlueBarFixedBehaviorController init elem a6f65671 elem a6f65671 WebCookieUseBannerController init elem b307cb32 elem b307cb32 AsyncRequestNectarLogging PagesTimelineChaining init elem pageID true onMessageEnabled TimezoneAutoset elem f46f4946 elem f46f4946 ScreenDimensionsAutoSet elem f46f4946 elem f46f4946 LoginFormController init elem null true QuickSandSolver solveAndUpdateForm u003C?? u013ae u000f4? f???r?I Hj? u0002?w?W?S?? login form AZkYwuDfeS98JRIaFn1WlNMuhJeqECLnDtohDLGGjqEgr0ZjwJ UzEQr5HxwyUQMRT14JA5bgFO XYi UvmlTJ4k R7Kiaj-VPHHZkJ9L6NvqEg FlipDirectionOnKeypres ReactRenderer constructAndRenderComponentAcrossTransition PagesSidebar react elem a588f507 PagesSidebar react module PagesManagerPromoteButton null nameData editable isMessagingEnabled language null name Landesjugendjazzorchester Hamburg pageID pageURI ljjohamburg ?ref page internal rtl null username ljjohamburg usernameEditDialogProfilePictureURI scontent-fra3-1 fbcdn net p60x60 jpg?oh und not verified pageID profilePictureData editable loading module PagesProfilePictureEditMenu null pageHasPhoto true pageID photoID photoIsSquare true size uri scontent-fra3-1 fbcdn net p160x160 jpg?oh edce92b12c70b4371172f9049f2ddcce und videoData null selectedKey home showAddSection showCreatePageButton true showPromotePageButton showManageSection tabsDataLegacy href www facebook com ljjohamburg ?ref page internal key home label Startseite show nux href ljjohamburg about ?entry point page nav about item und ref page internal key info label Info show nux href www facebook com ljjohamburg photos?ref page internal key photo label Foto show nux href www facebook com ljjohamburg likes?ref page internal key like label u201eGef u00e4llt mir u201c-Angaben show nux href www facebook com ljjohamburg events?ref page internal key label Veranstaltungen show nux href www facebook com ljjohamburg videos?ref page internal key video label Video show nux href www facebook com ljjohamburg posts?ref page internal key post label Beitr u00e4ge show nux elem a588f507 ReactRenderer constructAndRenderComponentAcrossTransition PagesHeaderRoot react PagesActionsUnitContainer react elem a588f507 PagesHeaderRoot react actionsUnitData likeFollowData null messageData null moreMenuItemConfig label u00c4nderungen vorschlagen uri page suggest dialog php?id und page und entry point timeline action menu suggest edit und session und last action time uriRel dialog label Seite melden uri nfx start crossOrigin xCjGJ type src static fbcdn net rsrc php yg 0xaZKbjJdTW crossOrigin Ly5B9 type src static fbcdn net rsrc php yg cJY -pFk2z2 crossOrigin true Bootloader enableBootload AsyncSignal resource GlfBq oOX1J module XLinkshimLogController resource GlfBq DB9bI oeUXN module ExceptionDialog resource DB9bI GlfBq DxiWu oOX1J bpiq3 voQ9g tkDGd qy bpxHv lugNi module React resource voQ9g GlfBq oOX1J module AsyncDOM resource GlfBq oOX1J d25Q1 module ConfirmationDialog resource GlfBq oOX1J zlWj module Dialog resource GlfBq DB9bI oOX1J DxiWu bpiq3 tkDGd gHZav module QuickSandSolver resource GlfBq oOX1J DB9bI ccpBO pqMUx module ErrorSignal resource GlfBq oOX1J DB9bI dmz7A module ReactDOM resource voQ9g GlfBq oOX1J module Animation resource GlfBq DB9bI oOX1J DxiWu module AsyncDialog resource GlfBq oOX1J DB9bI DxiWu bpiq3 voQ9g tkDGd module AsyncRequest resource GlfBq oOX1J module FormSubmit resource GlfBq oOX1J ZG21n module DialogX resource DB9bI GlfBq DxiWu oOX1J bpiq3 module XUIDialogBody react resource voQ9g GlfBq oOX1J tkDGd DB9bI bpiq3 qy module XUIDialogButton react resource voQ9g GlfBq oOX1J DB9bI tkDGd DxiWu module XUIDialogFooter react resource voQ9g GlfBq oOX1J tkDGd DB9bI bpiq3 DxiWu qy module XUIDialogTitle react resource voQ9g GlfBq oOX1J tkDGd DB9bI bpiq3 DxiWu module XUIGrayText react resource voQ9g GlfBq oOX1J tkDGd DB9bI module PageTransition resource GlfBq oOX1J DB9bI DxiWu Rpr16 bpiq3 voQ9g module Hovercard resource GlfBq oOX1J 07 DB9bI bpiq3 DxiWu vPi1t qy pxUXG module EncryptedImg resource GlfBq DB9bI viURX W0VQC module AsyncResponse resource GlfBq module Live resource GlfBq oOX1J d25Q1 DB9bI module PhotoInlineEditor resource GlfBq oOX1J cxJYu ZG21n bpiq3 VE3CK viURX vgSm2 7unvu module PhotoTagApproval resource GlfBq oOX1J cxJYu gqCHl module CompactTypeaheadRenderer resource GlfBq oOX1J bpiq3 viURX awcFH DB9bI IMQjU module ContextualTypeaheadView resource GlfBq oOX1J bpiq3 viURX IhN36 VE3CK DxiWu DB9bI module InputSelection resource GlfBq oOX1J DxiWu module HashtagParser resource IhN36 qy uck9V module MentionsInput resource GlfBq oOX1J LA7mc DxiWu Z7w5z viURX RGYiA 07 module TextAreaControl resource GlfBq ZG21n oOX1J module Typeahead resource GlfBq oOX1J bpiq3 IhN36 module TypeaheadAreaCore resource GlfBq oOX1J DxiWu ZG21n bpiq3 VE3CK Z7w5z module TypeaheadBestName resource viURX Z7w5z module TypeaheadHoistFriend resource Z7w5z module TypeaheadMetric resource GlfBq oOX1J JpAxz Z7w5z module TypeaheadMetricsX resource GlfBq oOX1J JpAxz kjpjc qfzTq module TypingDetector resource GlfBq TiCYn 6Y module UFIComment resource DB9bI GlfBq x4XcQ oOX1J viURX UXs3V module UFIAddCommentLiveTypingPublisher resource DB9bI GlfBq viURX UXs3V typPq oOX1J module UFIUploader resource GlfBq oOX1J DB9bI ubuDK bpiq3 LSDXi gHZav i72ur bpxHv ueRqu vgSm2 GKJFd DxiWu tkDGd viURX 07 Cfe2h xn module ScrollableArea resource GlfBq DB9bI oOX1J bpiq3 module XUIErrorDialogImpl resource GlfBq oOX1J 07 DB9bI bpiq3 DxiWu module ChatContentSearchFlyout react resource GlfBq oOX1J gMZ8j DB9bI faAFT xPJz9 voQ9g q4UA4 awcFH x4XcQ bpiq3 T3t7 MvwB8 trVCh j2zyN 6Y 07 tkDGd tN1bW DxiWu omcSJ iuk module ContextualLayerAutoFlip resource GlfBq DB9bI DxiWu module XUIContextualDialog react resource bpiq3 GlfBq 07 voQ9g oOX1J DB9bI DxiWu module RelayRootContainer resource voQ9g GlfBq oOX1J GaQyf DB9bI IhN36 07 module StickersStore react resource GlfBq DB9bI voQ9g oOX1J GaQyf viURX O4 IhN36 bpiq3 x4XcQ tkDGd HViB4 vOgha 6Y ttGD A8zMM qh2Qr HKbL4 0p44U RDvqO DQNa5 DxiWu zxk62 PdfT module StickersStorePackDetailRoute resource GaQyf voQ9g GlfBq oOX1J module StickersStorePackListRoute resource GaQyf voQ9g GlfBq oOX1J iFAbk module StickersFlyout react resource GlfBq voQ9g oOX1J DB9bI x4XcQ yFpzz GaQyf IhN36 07 yCy viURX 6Y DxiWu bpiq3 ttGD TiCYn omcSJ qy tkDGd HViB4 L3nF module EmoticonUtil resource bpiq3 viURX module EmoticonsList resource bpiq3 viURX module SelectionPosition resource GlfBq oOX1J DxiWu module OptimisticVideoComment react resource GlfBq DB9bI viURX W0VQC voQ9g oOX1J tkDGd DxiWu bpiq3 ZrZ0w MXCsw LSDXi 07 PWXP VVjXA KmcHv x4XcQ O5Rg9 HV j module Sticker react resource GlfBq DB9bI voQ9g oOX1J L3nF viURX yCy module UFIAttachedMediaPreview react resource voQ9g GlfBq oOX1J DB9bI bpiq3 W0VQC viURX tkDGd O5Rg9 ZAT3T module UFICommentMarkdownPreview react resource voQ9g GlfBq oOX1J DB9bI DxiWu bpiq3 qy tkDGd elthO PfISf pI7AA x Hnz7V module XUIAmbientNUX react resource voQ9g GlfBq oOX1J 07 DB9bI bpiq3 DxiWu tkDGd module UFIReactionsMenuImpl react resource GlfBq DB9bI voQ9g oOX1J dZ2Wl tkDGd x4XcQ 07 bpiq3 DxiWu NFP5Q viURX z02hq XpLdf MM5yP UXs3V module UFIReactionsMenuWithAnimatedVectorIcon react resource voQ9g GlfBq oOX1J i72ur 07 DB9bI dZ2Wl tkDGd x4XcQ bpiq3 DxiWu NFP5Q viURX z02hq XpLdf MM5yP UXs3V LY13N module UFIReactionsMenuWithStaticVectorIcon react resource voQ9g GlfBq oOX1J i72ur 07 DB9bI dZ2Wl tkDGd x4XcQ bpiq3 DxiWu NFP5Q viURX z02hq XpLdf MM5yP UXs3V module UFIReactionsNUX react resource GlfBq oOX1J DxiWu voQ9g DB9bI UXs3V 07 bpiq3 tkDGd g5ut module DOMScroll resource GlfBq oOX1J DB9bI module LegacyContextualDialog resource GlfBq oOX1J DxiWu KdFyq DB9bI 07 bpiq3 MuL1G module UFICommentMarkdownFormattedLink react resource voQ9g GlfBq oOX1J viURX UXs3V bpiq3 DB9bI DxiWu qy tkDGd bpxHv elthO IpY64 mZu06 module UFICreatorInfo react resource voQ9g GlfBq oOX1J x4XcQ KmcHv DB9bI tkDGd module UFIReactionsTooltipImpl react resource DB9bI GlfBq oOX1J voQ9g DxiWu bpiq3 qy UXs3V tRXKX module MultiPlacePageInfoCard react resource GlfBq oOX1J voQ9g W0VQC viURX DB9bI s4Kjt Gtby1 bpiq3 07 DxiWu tkDGd 4h olGeN jm6DP x4XcQ fYK4u QmbRE XCq3j krylL VlKZQ HyFoJ 2z WMugu 9Id2k uhPt8 MtNU2 yZc Yr4tN s5nED Aep HFiBb aD6RA BHpnP rbh BWUgz EL844 Bq1Oh jUWOI module PlaceListLiveCommentAttachment react resource 9Id2k GlfBq oOX1J voQ9g W0VQC viURX DB9bI s4Kjt Gtby1 bpiq3 07 DxiWu tkDGd 4h olGeN jm6DP x4XcQ fYK4u QmbRE XCq3j krylL VlKZQ HyFoJ 2z WMugu 073RM uhPt8 MtNU2 yZc Yr4tN s5nED Aep HFiBb aD6RA BHpnP rbh BWUgz EL844 Bq1Oh jUWOI module UFILiveCommentLinkPreview react resource voQ9g GlfBq oOX1J tkDGd DB9bI bpiq3 dZ2Wl kn9pk module ContextualDialogArrow resource GlfBq oOX1J DB9bI bpiq3 DxiWu module PopoverMenu react resource voQ9g GlfBq oOX1J tkDGd DB9bI DxiWu bpiq3 module ReactXUIMenu resource GlfBq oOX1J DxiWu DB9bI bpiq3 voQ9g module LtgTranslationPreference react resource GlfBq oOX1J x4XcQ DB9bI voQ9g n8oY3 tkDGd bpiq3 07 BkjC5 ZG21n HuHXx viURX qy vMGu2 Q5iEN dZ2Wl DxiWuXs3V omcSJ JpAxz module UFICommentRemovalControl react resource voQ9g GlfBq oOX1J DB9bI dZ2Wl GavI7 module UFIScrollHighlight resource GlfBq oOX1J DB9bI DxiWu JpAxz 43 rSdpp module PhotoTagger resource GlfBq oOX1J gqCHl 07 DB9bI bpiq3 DxiWu vPi1t qy pxUXG voQ9g OcdVT s8jAY cxJYu x4XcQ UXs3V viURX dZ2Wl tkDGd V2 module PhotoTag resource GlfBq oOX1J cxJYu gqCHl module PhotosButtonTooltip resource GlfBq oOX1J DxiWu DB9bI bpiq3 qy dC1 module SpotlightShareViewer resource GlfBq oOX1J DB9bI stJo3 DxiWu zyFOp module TagTokenizer resource GlfBq oOX1J viURX bpiq3 vgSm2 WRUgD VE3CK ZG21n module VideoRotate resource GlfBq oOX1J DB9bI DxiWu bpiq3 tkDGd gHZav module cs fb-photos-snowlift-fullscreen-cs resource VDymv PhotoSnowlift resource GlfBq oOX1J voQ9g DB9bI DxiWu bpiq3 tkDGd gHZav viURX W0VQC eFF x4XcQ cxJYu stJo3 Rpr16 gj module Toggler resource GlfBq oOX1J DB9bI bpiq3 DxiWu module Tooltip resource GlfBq oOX1J DxiWu DB9bI bpiq3 qy module DOM resource GlfBq oOX1J module Form resource GlfBq oOX1J module Input resource GlfBq module trackReferrer resource module FantaTabAction resource GlfBq oOX1J voQ9g DB9bI TiCYn module MercuryThread resource GlfBq x4XcQ oOX1J viURX voQ9g TiCYn DB9bI n3CYQ bpiq3 module PageUsernameEditDialog react resource GlfBq oOX1J DB9bI voQ9g tkDGd viURX DxiWu x4XcQ bpiq3 qy s8jAY NaGQN omcSJ 07 o1Jm2 module FbFeedPager react resource voQ9g GlfBq oOX1J okiCZ module Event resource GlfBq module UFIOrderingModeSelectorContainer react resource GlfBq oOX1J voQ9g x4XcQ DB9bI tkDGd DxiWu bpiq3 dZ2Wl Xdw2r omcSJ module UFILiveTypingIndicator react resource GlfBq DB9bI oOX1J DxiWu voQ9g L3nF u4Ux6 x4XcQ tkDGd viURX dZ2Wl PAPKn UDUHA module UFICommentNuxForGroupMallAd react resource voQ9g GlfBq oOX1J tkDGd DB9bI sNVrJ EfnuB bpiq3 vodRa SGr0U KOxvZ module UFIGroupMallAdsLikeNux react resource GlfBq oOX1J cuhXP voQ9g DB9bI sQuNJ 07 z02hq bpiq3 DxiWu tkDGd kEv1C module ReactComposerHandleUnsavedChange resource ueRqu voQ9g GlfBq oOX1J DB9bI DxiWu Rpr16 bpiq3 x4XcQ GKJFd omcSJ qy tkDGd Vfl6 ubuDK bpxHv vgSm2 gHZav LSDXi viURX 07 Cfe2h Q31vU pflQ4 vyazp module Run resource module URI resource GlfBq module curry resource GlfBq voQ9g module ComposerXMarauderLogger resource ueRqu G5xqN GlfBq oOX1J KmcHv viURX x4XcQ module ComposerXSessionID resource GlfBq oOX1J KmcHv viURX G5xqN module ReactComposerLoggingStore resource Q31vU G5xqN ueRqu GlfBq oOX1J KmcHv viURX x4XcQ Vfl6 bpxHv DB9bI voQ9g GKJFd omcSJ DxiWu bpiq3 qy tkDGd ubuDK vgSm2 gHZav LSDXi 07 Cfe2h pflQ4 module ReactComposerPerfLogger resource G5xqN GlfBq oOX1J KmcHv viURX x4XcQ Q31vU module UFIShareNowMenu react resource GlfBq oOX1J DB9bI bpiq3 DxiWu 07 voQ9g tkDGd LA7mc Djx gHZav ueRqu MGi5n eFF x4XcQ Q31vU 9a5fi SOPeK BWKWU viURX dZ2Wl module InlineFeedback react resource GlfBq oOX1J s5q8 voQ9g DB9bI QMKQw module UFICrowdsourceLabelingContainer react resource voQ9g GlfBq oOX1J JQyio module UFIActionLinkController resource voQ9g GlfBq oOX1J DB9bI VmVOI x4XcQ viURX dZ2Wl UXs3V tkDGd ZoAV module UFICommentRemoveDialog resource voQ9g GlfBq oOX1J DB9bI DxiWu bpiq3 qy tkDGd omcSJ cjC4v module requireLazy function ix add image loader indicator blue small gif sprited uri static fbcdn net rsrc php yb GsNJNwuI-UM gif 16 image mercury client messenger core LoadingSpinner png sprited true sp spriteCssClas sx image mercury client messenger core LoadingSpinnerExtraLarge png sprited true sp spriteCssClas sx image mercury client messenger core LoadingSpinnerGrey png sprited true sp spriteCssClas sx e241bb image chat composer png sprited uri static fbcdn net rsrc php MVLY03UaITD png 16 16 image messaging sticker store basket png sprited true sp avtVGZ81hWA sx ff93dd image messaging sticker store character png sprited true sp avtVGZ81hWA sx image messaging sticker store backarrow png sprited true sp avtVGZ81hWA sx image messaging sticker icon emoji png sprited true sp HIzz7r-unKq sx image messaging sticker icon recent png sprited true sp HIzz7r-unKq sx image messaging sticker icon png sprited true sp HIzz7r-unKq sx image messaging sticker selector left png sprited true sp HIzz7r-unKq sx image messaging sticker selector right png sprited true sp HIzz7r-unKq sx image messaging sticker selector sticker store png sprited true sp HIzz7r-unKq sx d31249 image messaging sticker icon sad face png sprited true sp HIzz7r-unKq sx image loader indicator black gif sprited uri static fbcdn net rsrc php y7 pgEFhPxsWZX gif 32 32 image loader indicator blue large gif sprited uri static fbcdn net rsrc php y9 jKEcVPZFk-2 gif 32 32 image loader indicator blue medium gif sprited uri static fbcdn net rsrc php yk LOOn0JtHNzb gif 16 16 image loader indicator white large gif sprited uri static fbcdn net rsrc php yG b53Ajb4ihCP gif 32 32 image loader indicator white small gif sprited uri static fbcdn net rsrc php y- AGUNXgX Wx3 gif 16 image asset DO NOT HARDCODE glyph hide fig-dark-50 png sprited true sp sQPvHyhCI sx f18c45 image asset DO NOT HARDCODE glyph gear fig-dark-50 png sprited true sp sQPvHyhCI sx b98922 image asset DO NOT HARDCODE glyph cros 20 fig-dark-50 png sprited true sp vq1vfXjN4sD sx image asset DO NOT HARDCODE glyph star fig-light-20 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph star fig-light-20 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph star fig-light-20 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph star fig-light-20 png sprited true sp spriteCssClas sx ee1b3c image page contextual recommendation star orange png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph star accent-blue png sprited true sp spriteCssClas sx c7642d image asset DO NOT HARDCODE glyph star accent-blue png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph star accent-blue png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph star accent-blue png sprited true sp spriteCssClas sx e985c5 image asset DO NOT HARDCODE glyph star fig-white png sprited true sp spriteCssClas sx a35f63 image asset DO NOT HARDCODE glyph rotate fig-dark-50 png sprited true sp sQPvHyhCI sx image browse smurfbar gear-icon png sprited true sp sQPvHyhCI sx image translation gear icon gray png sprited true sp sQPvHyhCI sx ee9e4c image asset DO NOT HARDCODE glyph chevron-down fig-light-20 png sprited true sp wMEheUOqJ8I sx image asset DO NOT HARDCODE glyph pushpin fig-blue png sprited true sp wMEheUOqJ8I sx f1c086 arrow-right white small sprited true sp spriteCssClas sx dc12ec image asset DO NOT HARDCODE glyph checkmark fig-green png sprited true sp f81W9WXcKzj sx image asset DO NOT HARDCODE glyph cros 20 fig-red png sprited true sp f81W9WXcKzj sx bfce4c image ui xhp link more down caret gif sprited true sp gDv-9wUhRD8 sx a6df47 image asset DO NOT HARDCODE glyph info-solid accent-blue png sprited true sp Wz7 AXF8lkZ sx f322e4 image asset DO NOT HARDCODE glyph info-solid fig-white png sprited true sp Vg0Mf3fbnov sx image asset DO NOT HARDCODE glyph 3-dots-h fig-white png sprited true sp wMEheUOqJ8I sx image asset DO NOT HARDCODE glyph plu 16 fig-blue png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph checkmark-solid accent-blue png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph checkmark-solid fig-dark-50 png sprited true sp spriteCssClas sx e45e88 image cropper drag png sprited true sp spriteCssClas sx d2d09e error-solid white small sprited true sp spriteCssClas sx d19331 info-solid white small sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph checkmark fig-dark-70 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph checkmark fig-white png sprited true sp VgAnjEW6DCx sx cb302d image asset DO NOT HARDCODE glyph pencil fig-light-30 png sprited true sp spriteCssClas sx c13350 image ui button dark chevron png sprited true sp gDv-9wUhRD8 sx image ui button normal chevron png sprited true sp gDv-9wUhRD8 sx image asset DO NOT HARDCODE glyph feed fig-blue png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph feed fig-light-20 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph like fig-blue png sprited true sp spriteCssClas sx e23e20 image asset DO NOT HARDCODE glyph like fig-light-20 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph link fig-light-20 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph app-messenger fig-light-20 png sprited true sp spriteCssClas sx image asset DO NOT HARDCODE glyph 3-dots-h fig-light-20 png sprited true sp spriteCssClas sx ba7a19 requireLazy InitialJSLoader function InitialJSLoader InitialJSLoader loadOnDOMContentReady GWrUV GlfBq DB9bI LA7mc pqMUx voQ9g DH7vG stJo3 DxiWu ccpBO Q5iEN Rpr16 TiCYn x4XcQ qy s8jAY 07 te30W xCjGJ Ly5B9 Xdw2r omcSJ UXs3V viURX JpAxz V2 onloadRegister DEPRECATED function try email focu catch ignore ilabilityStatu null MercuryParticipantsConstant UNKNOWN GENDER EMAIL image messaging threadlist envelope png IMAGE SIZE BIG IMAGE SIZE 109 MessengerEmojiConfig emoji color 127996 127998 1401 MessagingConfig IDLE CUTOFF SEND CONNECTION RETRIE SEND BATCH LIMIT syncFetchRetrie syncFetchInitialTimeoutM 1500 syncFetchTimeoutMultiplier syncFetchRequestTimeoutM 10000 CurrentEnvironment facebookdotcom true messengerdotcom 827 HubbleSurface PAGE INSIGHT PAGE TIMELINE 514 MercuryServerRequestsConfig 45000 MercuryThreadlistConstant RECENT THREAD OFFSET JEWEL THREAD COUNT JEWEL MORE COUNT WEBMESSENGER THREAD COUNT WEBMESSENGER MORE COUNT WEBMESSENGER SNIPPET COUNT WEBMESSENGER SNIPPET LIMIT WEBMESSENGER SNIPPET MORE WEBMESSENGER MORE MESSAGE COUNT RECENT MESSAGE LIMIT MAX UNREAD COUNT MAX UNSEEN COUNT MESSAGE NOTICE INACTIVITY THRESHOLD GROUPING THRESHOLD MESSAGE TIMESTAMP THRESHOLD TAB MAX CHAR BEFORE BREAK 96 ChatConfigInitialData PresencePrivacyInitialData requireLazy Bootloader function Bootloader setResourceMap GlfBq type src static fbcdn net rsrc php v3ig504 l znE1Sz3lGKu crossOrigin DB9bI type src static fbcdn net rsrc php v3i44-4 l a6GXkHzzgev crossOrigin oeUXN type src static fbcdn net rsrc php y5 47uHGzMUrOd crossOrigin DxiWu type src static fbcdn net rsrc php v3i8op4 l Rpt3By-y1UR crossOrigin voQ9g type src static fbcdn net rsrc php yG o4kTtqNf6lF crossOrigin gj type src static fbcdn net rsrc php v3izUs4 l gQknVIj3unz crossOrigin bpxHv type src static fbcdn net rsrc php v3i8op4 l EwtoswvX1IE crossOrigin lugNi type src static fbcdn net rsrc php v3iy-s4 l msJe7FCS1Cx crossOrigin d25Q1 type src static fbcdn net rsrc php ya 9Nm0zF6vhHJ crossOrigin zlWj type src static fbcdn net rsrc php yr 0ZGqaL2sTfC crossOrigin gHZav type src static fbcdn net rsrc php v3ilXE4 l n1joz4yOuIk crossOrigin ccpBO type src static fbcdn net rsrc php yJ SN6qBmEx4ek crossOrigin pqMUx type src static fbcdn net rsrc php y5 f7nU8Zyvqq crossOrigin dmz7A type src static fbcdn net rsrc php v3iWu74 l j crossOrigin ZG21n type src static fbcdn net rsrc php yk Hya3YNaHqaC crossOrigin Rpr16 type src static fbcdn net rsrc php v3iIu yb Yg j crossOrigin O4 type src static fbcdn net rsrc php v3iXgm4 l k2BK5PQNd crossOrigin pxUXG type src static fbcdn net rsrc php v3iLS74 l IuujphjE14F crossOrigin viURX type src static fbcdn net rsrc php v3inkH4 l nQSGTDBESN6 crossOrigin W0VQC type src static fbcdn net rsrc php v3i8op4 l W1kHeM-ZCac crossOrigin cxJYu type src static fbcdn net rsrc php v3iC y2 ldFLL68nHxo crossOrigin VE3CK type src static fbcdn net rsrc php v3iF0q4 l BxpPuUh1Nge crossOrigin 7WpvF type src static fbcdn net rsrc php v3iuRz4 l XpBmpOcXEzJ crossOrigin 7unvu type src static fbcdn net rsrc php y- GXNHL59M6Y9 crossOrigin gqCHl type src static fbcdn net rsrc php yH BrjUa3stUC7 crossOrigin awcFH type cs src static fbcdn net rsrc php y r a6w4bBhjiP cs permanent crossOrigin IMQjU type src static fbcdn net rsrc php yJ x507sL5Jv3v crossOrigin IhN36 type src static fbcdn net rsrc php v3isQf4 l j crossOrigin uck9V type src static fbcdn net rsrc php v3ic8D4 l j crossOrigin LA7mc type src static fbcdn net rsrc php v3iGig4 l V4EO5ZYmeB- crossOrigin Z7w5z type src static fbcdn net rsrc php RQ02kZkDotV crossOrigin RGYiA type cs src static fbcdn net rsrc php yV 1utwN cs crossOrigin JpAxz type src static fbcdn net rsrc php yk aflO kGRqTL crossOrigin kjpjc type src static fbcdn net rsrc php yi 6MzrVbuFI6P crossOrigin qfzTq type src static fbcdn net rsrc php e8FXcQ1hiDh crossOrigin TiCYn type src static fbcdn net rsrc php v3iOsv4 l 6iI-kxl1E crossOrigin 9a type src static fbcdn net rsrc php v3ijpb4 l SkHcZGnT-5o crossOrigin x4XcQ type src static fbcdn net rsrc php v3iJZz4 l uPQTAcQQtlJ crossOrigin UXs3V type src static fbcdn net rsrc php v3ikzM4 l t0j6iP63XJi crossOrigin typPq type src static fbcdn net rsrc php yT N62ckV7P3-c crossOrigin ubuDK type src static fbcdn net rsrc php v3iNSJ4 l j793t23ytKf crossOrigin LSDXi type src static fbcdn net rsrc php v3ihBw4 l adh6qlY abi crossOrigin i72ur type src static fbcdn net rsrc php v3ienm4 l qrpW3i-7R3v crossOrigin ueRqu type src static fbcdn net rsrc php v3iHJp4 l BR1HKdd29up crossOrigin GKJFd type src static fbcdn net rsrc php v3i8jJ4 l tK6hZHvmoya crossOrigin Cfe2h type src static fbcdn net rsrc php yJ MA1O2A1etc8 crossOrigin wE type src static fbcdn net rsrc php yx ilDXfIeRfWl crossOrigin 2pvUV type src static fbcdn net rsrc php yJ VC3QJKvwkbK crossOrigin gMZ8j type src static fbcdn net rsrc php yW 6o6ClvJhT5b crossOrigin faAFT type src static fbcdn net rsrc php yx sLbufzO7jXI crossOrigin xPJz9 type src static fbcdn net rsrc php yM AusFxSEn2kZ crossOrigin q4UA4 type cs src static fbcdn net rsrc php yK KKFFF9zb3v cs permanent crossOrigin 8c2RR type src static fbcdn net rsrc php VkP2N8qsCdM crossOrigin 3nr64 type src static fbcdn net rsrc php v3im4M4 l QoB-0UXKbUD crossOrigin T3t7 type src static fbcdn net rsrc php y r bArgvqBZzgt crossOrigin MvwB8 type cs src static fbcdn net rsrc php yy CNPqWoAN0Oa cs permanent crossOrigin trVCh type src static fbcdn net rsrc php v3iqYx4 l j crossOrigin j2zyN type src static fbcdn net rsrc php yu Ls-t rza-Ne crossOrigin tN1bW type src static fbcdn net rsrc php KkemtvrAibK crossOrigin omcSJ type src static fbcdn net rsrc php v3inGp4 l Ldqz5RachMp crossOrigin j iuk type src static fbcdn net rsrc php v3iDF94 l j crossOrigin GaQyf type src static fbcdn net rsrc php 2zKFX150QEj crossOrigin 6hAeo type src static fbcdn net rsrc php v3izYn4 l WXRcNhtdlfI crossOrigin HViB4 type cs src static fbcdn net rsrc php yv 7t6iLK7HUCu cs permanent crossOrigin vOgha type src static fbcdn net rsrc php v3iAWl4 l eQKhjLFJ3tB crossOrigin ttGD type src static fbcdn net rsrc php ya TIrTAO6uY74 crossOrigin A8zMM type src static fbcdn net rsrc php v3iKcC4 l CQmd P--0vt crossOrigin 19APk type src static fbcdn net rsrc php v3i0Rg4 l KOU1Beqdnaq crossOrigin qh2Qr type cs src static fbcdn net rsrc php y6 xcbHaKG-VgT cs permanent crossOrigin HKbL4 type src static fbcdn net rsrc php Ib46r F1uvt crossOrigin 179R3 type src static fbcdn net rsrc php v3iPRw4 l j1hFSQ9411z crossOrigin 0p44U type src static fbcdn net rsrc php yq tqAXnr2PFpt crossOrigin RDvqO type src static fbcdn net rsrc php v3iMmo4 l oyaOmzWcs5 crossOrigin DQNa5 type src static fbcdn net rsrc php yu 8-40Xr4f6he crossOrigin zxk62 type src static fbcdn net rsrc php v3iWSE4 l j crossOrigin PdfT type cs src static fbcdn net rsrc php yp -wu-wARo0zD cs nonblocking crossOrigin 0kNoC type src static fbcdn net rsrc php y3 a90jGOObSUJ crossOrigin iFAbk type src static fbcdn net rsrc php y Y0aXXAlmjoy crossOrigin yFpzz type src static fbcdn net rsrc php v3iQyV4 l YDBW7RVgYSh crossOrigin yCy type src static fbcdn net rsrc php v3iNhT4 l EH6d WCpoUA crossOrigin L3nF type cs src static fbcdn net rsrc php yP cEojUZBNohF cs permanent crossOrigin 1Q8bY type src static fbcdn net rsrc php v3iqzp4 l DNn0 eEi5iQ crossOrigin ZrZ0w type cs src static fbcdn net rsrc php yW npHqj3MrVTx cs permanent crossOrigin MXCsw type src static fbcdn net rsrc php v3idIA4 l wRsDaJnoctJ crossOrigin PWXP type src static fbcdn net rsrc php yJ ftqYJRfB-Tu crossOrigin VVjXA type src static fbcdn net rsrc php y3 FusxZ5TvpNO crossOrigin KmcHv type cs src static fbcdn net rsrc php yW kf3Urv691Wn cs permanent crossOrigin O5Rg9 type cs src static fbcdn net rsrc php yv FVI1FzPODeg cs permanent crossOrigin HV j type src static fbcdn net rsrc php v3i2yW4 l mhMuV3ekk- crossOrigin ZAT3T type src static fbcdn net rsrc php v3ipMu4 l j crossOrigin PfISf type src static fbcdn net rsrc php v3i2Gp4 l cxOX5BI5-OD crossOrigin pI7AA type cs src static fbcdn net rsrc php y4 78SF-tuzC- cs crossOrigin 0Qz type src static fbcdn net rsrc php yi PmIa-N9xJlu crossOrigin Hnz7V type src static fbcdn net rsrc php v3iPFZ4 l NeY03EV1E8X crossOrigin NFP5Q type src static fbcdn net rsrc php y2 6aDZ0 JpLZY crossOrigin z02hq type src static fbcdn net rsrc php v3iFkw4 l j crossOrigin XpLdf type cs src static fbcdn net rsrc php yO x5tFlr0gI6x cs permanent crossOrigin MM5yP type src static fbcdn net rsrc php v3ikO04 l ORwu5zkJ-xM crossOrigin LY13N type src static fbcdn net rsrc php yi NINSDmE0T3G crossOrigin g5ut type src static fbcdn net rsrc php v3idMq4 l umGzRUEQftI crossOrigin KdFyq type src static fbcdn net rsrc php yw FhVmK6YG43- crossOrigin MuL1G type cs src static fbcdn net rsrc php y6 sT-2fYRKH5Y cs permanent crossOrigin 8aeA9 type src static fbcdn net rsrc php yJ 3WG90 He1ii crossOrigin IpY64 type src static fbcdn net rsrc php v3iy4V4 l h7PGWcMW0Pm crossOrigin mZu06 type src static fbcdn net rsrc php v3ijXR4 l j crossOrigin 8Aozk type src static fbcdn net rsrc php v3iA0 yb 0UOwEZ9cUGt crossOrigin 84LHB type cs src static fbcdn net rsrc php yu v1NBgegK6AQ cs crossOrigin tRXKX type src static fbcdn net rsrc php v3iPtv4 l a9fw4I2Rq7Y crossOrigin s4Kjt type src static fbcdn net rsrc php yK WzRPQ6N2F-u crossOrigin Gtby1 type src static fbcdn net rsrc php iJ5QtBFHN-c crossOrigin 9PD6w type cs src static fbcdn net rsrc php yV 25bo3CvWya cs crossOrigin 4h type src static fbcdn net rsrc php v3i8uR4 l j crossOrigin olGeN type cs src static fbcdn net rsrc php yH qG2FR7KJawW cs crossOrigin jm6DP type src static fbcdn net rsrc php v3i2FC4 l IxnT JkmkjW crossOrigin fYK4u type src static fbcdn net rsrc php yO G1ER-XUFYw8 crossOrigin QmbRE type src static fbcdn net rsrc php yt TBItHJGxd2j crossOrigin XCq3j type src static fbcdn net rsrc php yr irtczbDjaA4 crossOrigin krylL type src static fbcdn net rsrc php P91gIlgHnZ9 crossOrigin VlKZQ type src static fbcdn net rsrc php yh LnVBaGHdKwZ crossOrigin HyFoJ type src static fbcdn net rsrc php yh vP1 j crossOrigin WK type src static fbcdn net rsrc php ye dKswCcAefjr crossOrigin 0rdkb type cs src static fbcdn net rsrc php yb 7tfF9DtOnl cs crossOrigin WMugu type src static fbcdn net rsrc php v3iCAf4 l lEtQpHbPaSc crossOrigin 0NFR9 type src static fbcdn net rsrc php yh kM5WvPXpcD3 crossOrigin 9Id2k type src static fbcdn net rsrc php y1 fFlIBY2i4gY crossOrigin 073RM type src static fbcdn net rsrc php yG hEtGy8lSH j crossOrigin uhPt8 type src static fbcdn net rsrc php y XmmghAmFafh crossOrigin MtNU2 type src static fbcdn net rsrc php y4 kQR3tkh64 j crossOrigin yZc type src static fbcdn net rsrc php yW aFGGZhIXfUR crossOrigin Yr4tN type src static fbcdn net rsrc php yF mACuR2rC6z j crossOrigin s5nED type src static fbcdn net rsrc php yo OlfE3npOFEq crossOrigin Aep type cs src static fbcdn net rsrc php yR Lv9m1srLwt5 cs crossOrigin HFiBb type src static fbcdn net rsrc php yd NIOJfx aw2n crossOrigin 88HWy type cs src static fbcdn net rsrc php yI SRA4j2kLAmb cs crossOrigin aD6RA type src static fbcdn net rsrc php v3i1sQ4 l IM1yJASXEMd crossOrigin BHpnP type cs src static fbcdn net rsrc php yb NblZNBCa5RH cs crossOrigin rbh type src static fbcdn net rsrc php v3i5MT4 l j crossOrigin BWUgz type cs src static fbcdn net rsrc php yu Ps2bJXcFYzD cs crossOrigin EL844 type src static fbcdn net rsrc php v3ig034 l klFHCHzGleM crossOrigin Bq1Oh type cs src static fbcdn net rsrc php ussHstT bs2 cs crossOrigin jUWOI type src static fbcdn net rsrc php yv -H9ru5iwunm crossOrigin 2azk8 type src static fbcdn net rsrc php yV 18moU0WsiMT crossOrigin 8ZOng type src static fbcdn net rsrc php y9 VC9o1uHKKo crossOrigin kn9pk type src static fbcdn net rsrc php v3ifii4 l dpbyYVVwXSa crossOrigin n8oY3 type src static fbcdn net rsrc php yh 4BnF73lkWpB crossOrigin BkjC5 type src static fbcdn net rsrc php v3ibdz4 l poffNXK7Zev crossOrigin HuHXx type cs src static fbcdn net rsrc php yM jDi40zd1ZpW cs crossOrigin Q5iEN type src static fbcdn net rsrc php v3ii6x4 l rn2HLh14G0E crossOrigin GavI7 type src static fbcdn net rsrc php v3iWrN4 l -FGdWtght3h crossOrigin v3 type src static fbcdn net rsrc php y4 PK97cHbhCVR crossOrigin rSdpp type src static fbcdn net rsrc php yM lByCgd4QJPD crossOrigin s8jAY type src static fbcdn net rsrc php yv mwRDsZjzlJ8 crossOrigin ZT type src static fbcdn net rsrc php v3i9e24 l x2egUgTmkO7 crossOrigin dC1 type src static fbcdn net rsrc php yt A9nU9YC0Yqj crossOrigin stJo3 type src static fbcdn net rsrc php yC PQmJhrB2Rqb crossOrigin zyFOp type src static fbcdn net rsrc php yr b4lU7m6-h3j crossOrigin WRUgD type src static fbcdn net rsrc php v3i8yB4 l V4gZb96E45a crossOrigin 6AU0l type src static fbcdn net rsrc php v3i9mv4 l GRzo9409MOA crossOrigin VDymv type cs src static fbcdn net rsrc php yM kb34-aZxP0x cs permanent crossOrigin eFF type src static fbcdn net rsrc php yH Bbxw2vZD3 j crossOrigin 69aam type cs src static fbcdn net rsrc php nc8nLAF7TC8 cs permanent crossOrigin n3CYQ type src static fbcdn net rsrc php yG UbvKhE0yLvO crossOrigin NaGQN type src static fbcdn net rsrc php v3igPc4 l Spyav7YpzJZ crossOrigin o1Jm2 type cs src static fbcdn net rsrc php yJ PCnUJOcnqUw cs crossOrigin 9mslm type cs src static fbcdn net rsrc php 9whhR1gwSC4 cs nonblocking crossOrigin okiCZ type src static fbcdn net rsrc php v3io8l4 l UnGXHYPgUB1 crossOrigin Xdw2r type src static fbcdn net rsrc php yQ 3tSNr5aS14e crossOrigin u4Ux6 type src static fbcdn net rsrc php v3iGrV4 l CJEXFcd5wd crossOrigin PAPKn type cs src static fbcdn net rsrc php y6 faSWdQwt6KC cs crossOrigin UDUHA type src static fbcdn net rsrc php v3i6vE4 l ncWZ crossOrigin sNVrJ type cs src static fbcdn net rsrc php yj 8VtBMinD7rn cs crossOrigin EfnuB type src static fbcdn net rsrc php v3i3Sp4 l GPOAQc8jLTu crossOrigin vodRa type cs src static fbcdn net rsrc php yM MX83t1yWuMQ cs crossOrigin SGr0U type src static fbcdn net rsrc php v3ityB4 l O3nizOa3k1 j crossOrigin KOxvZ type cs src static fbcdn net rsrc php yW 7ssKfqkJjsx cs nonblocking crossOrigin cuhXP type src static fbcdn net rsrc php yF d0PgeIz65hB crossOrigin sQuNJ type src static fbcdn net rsrc php y1 U7rp777nX9r crossOrigin kEv1C type src static fbcdn net rsrc php v3ityB4 l j crossOrigin 9a5fi type src static fbcdn net rsrc php v3irbo4 l zwn64Ky0AFo crossOrigin Vfl6 type src static fbcdn net rsrc php y r A9id8K6f7kq crossOrigin 3eqrh type src static fbcdn net rsrc php y8 lYV3kSjx0c j crossOrigin Q31vU type src static fbcdn net rsrc php yd Z0jmTs86tbf crossOrigin pflQ4 type src static fbcdn net rsrc php ya hyZ5jucAVI j crossOrigin vyazp type src static fbcdn net rsrc php v3idZP4 l V9syfnl7RSV crossOrigin G5xqN type src static fbcdn net rsrc php v3iAdL4 l Z0sv0qNa7K4 crossOrigin Djx type src static fbcdn net rsrc php yD Dck7Cc vUAy crossOrigin MGi5n type src static fbcdn net rsrc php v3iWSr4 l ecj1UWxNV j crossOrigin SOPeK type src static fbcdn net rsrc php yH WreaA2guAPh crossOrigin BWKWU type src static fbcdn net rsrc php v3iRRu4 l RAr4UrhKegw crossOrigin s5q8 type src static fbcdn net rsrc php yX Tn-j5g0fwtM crossOrigin QMKQw type cs src static fbcdn net rsrc php y4 LX0GcuEtK54 cs crossOrigin 2EyDR type src static fbcdn net rsrc php v3icZx4 l j crossOrigin JQyio type src static fbcdn net rsrc php yr wiuAFAdskwR crossOrigin VmVOI type src static fbcdn net rsrc php v3ikfG4 l MvkZDvtaEE- crossOrigin ZoAV type src static fbcdn net rsrc php v3id0V4 l oLsdty-Y8Ff crossOrigin cjC4v type src static fbcdn net rsrc php v3iVN24 l S-Vu2p9ZLJd crossOrigin GWrUV type src static fbcdn net rsrc php v3iI3n4 l HtVznrCW5x7 crossOrigin DH7vG type src static fbcdn net rsrc php y6 XSJ814K1U9A crossOrigin 0dxqj type src static fbcdn net rsrc php y9 ld0WXGNCXiN crossOrigin te30W type src static fbcdn net rsrc php yF IJM0I8k2RgF a588f507 elem a588f507 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 1y object element 1y preview editable mall how many post comment shimparam page type actor story 1005140296207296 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1005140296207296 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1005140296207296 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Monika Beeh Manfred Schulz Malte Sorgenfrei und anderen gef u00e4llt range aggregatedrange alternate text Dir Monika Beeh Manfred Schulz Malte Sorgenfrei und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1005140296207296 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1005140296207296 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1005140296207296 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 23 object element 23 preview editable mall how many post comment shimparam page type actor story 998229506898375 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 998229506898375 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Erik Konertz David Drenic Bettina Knauer und anderen gef u00e4llt range aggregatedrange alternate text Dir Erik Konertz David Drenic Bettina Knauer und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 998229506898375 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 998229506898375 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment body text lohnt sich range aggregatedrange isfeatured likecount hasviewerliked canremove canreport canedit isauthorweakreference isauthornoncoworker istranslatable viewercanlike cancomment spamreplycount commentshareuri sharer ? 69 und appid und 998280683559924 und u00255B0 u00255D canembed canEditConstituentTitle 998280683559924 fbid legacyid author ftentidentifier source highlightcomment scrolltopoffset timestamp time text April verbose Freitag April 48 profile 100009667399982 100009667399982 name Beate Schl u00fcter firstName Beate vanity thumbSrc scontent-fra3-1 fbcdn net p32x32 161163210882591 jpg?oh e1d81a21e363d60ba0ee8bd3950a0f1d und 5838567E gender i18nGender type user friend action commentlist comment 998229506898375 ranked threaded range offset length value 998229506898375 count clienthasall true replie 998229506898375 range offset length value count ftentidentifier containerorderingmode ranked threaded featuredcommentlist comment null replie null featuredcommentid null servertime inst ReactRenderer constructAndRenderComponentAcrossTransition UFIReactionsSocialSentence react elem a588f507 UFIReactionsSocialSentence react feedback entidentifier reactioncount reactioncountreduced reactioncountmap default reduced reactionsentence supportedreaction max size elem a588f507 ReactRenderer constructAndRenderComponentAcrossTransition UFIReactionsSocialSentence react elem a588f507 UFIReactionsSocialSentence react feedback entidentifier reactioncount reactioncountreduced reactioncountmap default reduced reactionsentence supportedreaction max size elem a588f507 ReactRenderer constructAndRenderComponentAcrossTransition PagesMetabox react elem a588f507 PagesMetabox react categoryLabel MusikerIn Band locationLabel null openStatu null openStatusLabel null pageURIToken ljjohamburg rating elem a588f507 ReactionLogging elem logging data page type clicked view page like impression info eyJmIjp7Iml0ZW1fY291bnQiOiIwIn19 surface www page highlight interacted story type session 8694554c1a616131d9262846c54ea8eb true ReactionLogging elem logging data page type clicked view page about impression info eyJmIjp7Iml0ZW1fY291bnQiOiIwIn19 surface www page highlight interacted story type session 8694554c1a616131d9262846c54ea8eb true ChatOpenTab elem 686561928065136 null about row ExpandingCtaModern show elem a588f507 elem e980dec4 elem a588f507 elem e980dec4 Arbiter inform footerLoaded persistent inst e5ad243d inst IntlUtil DeferredCookie addToQueue datr fiPMV-wzbl2JdHC3SL7BzJze true DeferredCookie addToQueue reg ext ref www ljjo-hamburg true DeferredCookie addToQueue reg ref www facebook com ljjohamburg ?fref true DeferredCookie addToQueue reg gate www facebook com ljjohamburg ?fref true NavigationMetric setPage page XPagesProfileHomeController page type normal page uri www facebook com ljjohamburg ?fref serverLID HighContrastMode init isHCM spacerImage static fbcdn net rsrc php y4 -PAXP-deijE gif ClickRefLogger DetectBrokenProxyCache run user TimeSlice setLogging NavigationClickPointHandler UserActionHistory startLogging TimeSpentBitArrayLogger init define ImmediateActiveSecondsConfig sampling rate 423 TimeSpentConfig delay timeout 142 PhotosUploadWaterfallXConfig loggingEndpoint pixel facebook com photo logging waterfallx php banzaiRoute photo waterfall deprecatedBanzaiRoute photo waterfall deprecated useBanzai retryBanzai timeout true batchInterval 211 ComposerXNativeAudioUploadsConfig inNativeAudioUploadsGK audioExtension ogg m4a mp3 wav aiff flac 1138 photo duration photo transition duration min photo num max photo num audio file NONE ACTION BLUESCOUNTRY DANCE ELECTRICCOCONUT GARAGEGROOVE GOODMEMORIE HAPPYZONE JAZZYSAMBA LONGBOARD STRATO SWAMP THANK TIMELAPSE WONDER audio ACTION 1278035535570122 ACTION 1631691247152233 ACTION 1205372339525815 ACTION 1639087463078041 BLUESCOUNTRY 283949628622051 BLUESCOUNTRY 1047713968651124 BLUESCOUNTRY 1056988061049343 BLUESCOUNTRY 1043222382439285 DANCE 664101073740891 DANCE 254071148298707 DANCE 1238124936206366 DANCE 113720169056257 ELECTRICCOCONUT 1558586101114088 ELECTRICCOCONUT 212318379162305 ELECTRICCOCONUT 564368160431709 ELECTRICCOCONUT 151157048635835 GARAGEGROOVE 293959997609985 GARAGEGROOVE 1055941214497371 GARAGEGROOVE 1306442412717136 GARAGEGROOVE 1088061677899730 GOODMEMORIE 15 GOODMEMORIE 35 HAPPYZONE 1780358248844901 HAPPYZONE 498629387000231 HAPPYZONE 864400790326708 HAPPYZONE 1606639729628100 JAZZYSAMBA 143243489428995 JAZZYSAMBA 1751514995131605 JAZZYSAMBA 1002995439799798 JAZZYSAMBA 1623821304612326 LONGBOARD 285301678475987 LONGBOARD 1752571731647601 LONGBOARD 1736244266594197 LONGBOARD 263191944047184 STRATO 15 STRATO 35 SWAMP 104044846693466 SWAMP 146597055750373 SWAMP 551644518356682 SWAMP 146044805815298 THANK 15 THANK 35 TIMELAPSE 186168018451956 TIMELAPSE 798988446869437 TIMELAPSE 258569117839132 TIMELAPSE 1922947021265674 WONDER 657752611032111 WONDER 1117096745031375 WONDER 1645599055761471 WONDER 533341703534655 audio length audio fadeout audio source NONE storyline mood none default length second transition None Fade image fetch timeout format ORIGINAL Square Wide default num frame from video frame from video default num selected frame min num generated frame max num generated frame 50 max textoverlay character photo textoverlay font Aptifer Slab Pro Daytona Pro Glypha Pro Info Text Pro Slate Unit Rounded Pro user based slideshow with video compositor encoding textoverlay font Helvetica Neue Helvetica Aptifer Slab Pro Aptifer Slab Daytona Pro Daytona Glypha Pro Glypha Info Text Pro Info Text Slate Unit Rounded Pro Unit Rounded textoverlay color font color b9cad2 font color a3cedf font color a3ce71 font color fcd872 font color f7923b font color fb724b font color f35369 font color ec7ebd font color SphericalPhotoConfig spherical photo render www true spherical photo www upload true spherical photo www upload www spherical photo rubberbanding spherical photo www projection switch www spherical photo slip panning connected cast spherical photo www spherical photo mmp www spherical photo album 1426 ORIGINAL USER RTISubscriptionManagerConfig config max 150 www idle unsubscribe 600000 www idle unsubscribe override comment create subscribe autobot tier latest realtime skywalker autobot latest intern realtime skywalker autobot intern realtime skywalker autobot LocaleInitialData locale language Deutsch WorkFocusModeController WorkFocusMode null MessengerWorkAva ken filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg photo 1073741832 1053995091321816 ?type permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1053995091321816 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1053995091321816 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 1c object element 1c preview editable mall how many post comment shimparam page type actor story 1047392691982056 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1047392691982056 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Elise Kong Vivienne Lui Christiane Faehre-Wartisch und anderen gef u00e4llt range aggregatedrange alternate text Dir Elise Kong Vivienne Lui Christiane Faehre-Wartisch und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1047392691982056 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1047392691982056 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1047392691982056 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadRelatedAttachment 306047905327 LitestandShareAttachment init elem a588f507 elem a588f507 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 1f object element 1f preview editable mall how many post comment shimparam page type actor story 1039859372735388 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1039859372735388 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1039859372735388 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Malte Hildebrandt Denni Yener Katharina Kohl und anderen gef u00e4llt range aggregatedrange alternate text Dir Malte Hildebrandt Denni Yener Katharina Kohl und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1039859372735388 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1039859372735388 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment body text u00f6nnte mir jemand diese sagenumwobene zukommen lassen? Auf Rechnung ud83d ude09 range aggregatedrange isfeatured likecount hasviewerliked canremove canreport canedit isauthorweakreference isauthornoncoworker istranslatable viewercanlike cancomment spamreplycount interestingReplyId 1040182732703052 interestingReplyOffset commentshareuri sharer ? 69 und appid und 1040159246038734 und u00255B0 u00255D canembed canEditConstituentTitle 1040159246038734 fbid legacyid author ftentidentifier source highlightcomment scrolltopoffset timestamp time text Juni 22 verbose Donnerstag Juni 01 body text kriegen wir hin range aggregatedrange isfeatured likecount hasviewerliked canremove canreport canedit isauthorweakreference isauthornoncoworker istranslatable viewercanlike cancomment spamreplycount commentshareuri sharer ? 69 und appid und 1040182732703052 und u00255B0 u00255D canembed canEditConstituentTitle 1040182732703052 fbid legacyid author ftentidentifier source parentcommentid 1040159246038734 highlightcomment scrolltopoffset timestamp time text Juni 22 verbose Donnerstag Juni 52 originalTimestamp profile 100001272944586 100001272944586 name Julia Straske firstName Julia vanity julia straske thumbSrc scontent-fra3-1 fbcdn net p32x32 1180713308647756 jpg?oh und 584192A6 gender i18nGender type user friend action commentlist comment 1039859372735388 ranked threaded range offset length value 1039859372735388 count clienthasall true replie 1039859372735388 range offset length value 1039859372735388 count ftentidentifier containerorderingmode ranked threaded featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 1j object element 1j preview editable mall how many post comment shimparam page type actor story 1038424702878855 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1038424702878855 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1038424702878855 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Norma Schulz Lar Seniuk und Landesmusikrat Hamburg gef u00e4llt range aggregatedrange alternate text Dir Norma Schulz Lar Seniuk und Landesmusikrat Hamburg gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewR cancomment spamreplycount interestingReplyId 1074229935964998 interestingReplyOffset commentshareuri sharer ? 69 und appid und 1073354716052520 und u00255B0 u00255D canembed canEditConstituentTitle 1073354716052520 fbid legacyid author ftentidentifier source highlightcomment scrolltopoffset timestamp time text August 09 verbose Mittwoch August 20 body text Vielen Dank! haben wir Unsere neue New Sound range aggregatedrange isfeatured likecount hasviewerliked canremove canreport canedit isauthorweakreference isauthornoncoworker istranslatable viewercanlike cancomment spamreplycount commentshareuri sharer ? 69 und appid und 1074229935964998 und u00255B0 u00255D canembed canEditConstituentTitle 1074229935964998 fbid legacyid author ftentidentifier source parentcommentid 1073354716052520 highlightcomment scrolltopoffset timestamp time text August 14 verbose Donnerstag August 37 profile 686561928065136 name Landesjugendjazzorchester Hamburg firstName Landesjugendjazzorchester Hamburg vanity ljjohamburg thumbSrc scontent-fra3-1 fbcdn net p24x24 jpg?oh b1e19f274b44e12a3c2d4ff7b7f8bf37 und 587BDC06 uri www facebook com ljjohamburg type page friend action commentlist comment 1073126026075389 ranked threaded range offset length value 1073126026075389 count clienthasall true replie 1073126026075389 range offset length value 1073126026075389 count ftentidentifier containerorderingmode ranked threaded featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadRelatedAttachment 675891345817277 LitestandShareAttachment init elem a588f507 elem a588f507 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 10 object element 10 preview editable mall how many post comment shimparam page type actor story 1067706009950724 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1067706009950724 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1067706009950724 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Inge Noll Kristina Deger Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange alternate text Dir Inge Noll Kristina Deger Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1067706009950724 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1067706009950724 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1067706009950724 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 14 object element 14 preview editable mall how many post comment shimparam page type actor story 1054276694626989 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1054276694626989 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Ingo Schneider Marita Seniuk Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange alternate text Dir Ingo Schneider Marita Seniuk Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1054276694626989 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1054276694626989 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment body text Ken Dombrowski gut der Mann! range aggregatedrange isfeatured likecount hasviewerliked canremove canreport canedit isauthorweakreference isauthornoncoworker istranslatable viewercanlike cancomment spamreplycount commentshareuri sharer ? 69 und appid und 1054326101288715 und u00255B0 u00255D canembed canEditConstituentTitle 1054326101288715 fbid legacyid author ftentidentifier source highlightcomment scrolltopoffset timestamp time text Juli verbose Montag Juli 00 profile 100000197446108 100000197446108 name Michael Schugardt firstName Michael vanity michaelschugardt thumbSrc scontent-fra3-1 fbcdn net p32x32 1440681202615114 jpg?oh bd4dd59f0862a265c033acc451311d08 und 584367D6 gender i18nGender type user friend action commentlist comment 1054276694626989 ranked threaded range offset length value 1054276694626989 count clienthasall true replie 1054276694626989 range offset length value count ftentidentifier containerorderingmode ranked threaded featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadInlineStoryPivotAttachment I686561928065136 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 17 object element 17 preview editable mall how many post comment shimparam page type actor story 1053995091321816 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1053995091321816 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Ron Keinan Anke Fischer Julia Straske und anderen gef u00e4llt range aggregatedrange alternate text Dir Ron Keinan Anke Fischer Julia Straske und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention photo fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer to dialog?context u00257B u002522breadcrumb u00253A u00255B u00255D u00252C u002522story location u00253A u002522page u00252C u002522i from feed tombstone u00252C u002522action taken u00253A u00252C u002522reportable ent token u00253A u002522686561928065136 u00252C u002522i impostor u00253A u00257D uriRel dialog label Seite blockieren uri privacy block page ?page uriRel dialog-post label Teilen uri sharer ? 18 und appid und u00255B0 u00255D uriRel dialog label Eine Seite erstellen uri page create ?ref type page profile uriRel null pageID customActionsData null callToActionData null coverPhotoData focu 64364035087719 id original 1129 2048 uri scontent-fra3-1 fbcdn net t31 11864847 5244719694608091642 jpg editable loading module PagesCoverPhotoEditMenu null pageHasPhoto true pageID previewMode renderedHeight renderedWidth hasStickyHeader module PagesActionsUnitContainer react PagesActionBarChannelContainer null elem a588f507 searchPost elem a588f507 elem a588f507 elem a588f507 elem a588f507 ReactionLogging elem logging data page type clicked all page post impression info surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb true FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadRelatedAttachment 1086717164748264 LitestandShareAttachment init elem a588f507 elem a588f507 UFIOrderingModeSelectorContainer react UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true substory true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 9 object element 9 preview editable mall how many post comment shimparam page type actor story 1082376971816961 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1082376971816961 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink likeAjaxifyURI null showCommentLink commentAjaxifyURI null showShareLink shareAjaxifyURI null showAddComment addCommentAjaxifyURI null showBling true translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode none feedbackReferrer feedcarded true instanceid lazyFetch true numLazyComment pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1082376971816961 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Beate Schl u00fcter Sven Kagelmann Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange alternate text Dir Beate Schl u00fcter Sven Kagelmann Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1082376971816961 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1082376971816961 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1082376971816961 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime ReactionLogging elem logging data page type clicked all page video impression info surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb true ReactionLogging elem logging data page type clicked all page photo impression info eyJmIjp7Iml0ZW1fY291bnQiOiIwIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb true FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadRelatedAttachment 1086717164748264 LitestandShareAttachment init elem a588f507 elem a588f507 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element f object element f preview editable mall how many post comment shimparam page type actor story 1082376971816961 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1082376971816961 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1082376971816961 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Beate Schl u00fcter Sven Kagelmann Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange alternate text Dir Beate Schl u00fcter Sven Kagelmann Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1082376971816961 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1082376971816961 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1082376971816961 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadRelatedAttachment 1086440084773066 LitestandShareAttachment init elem a588f507 elem a588f507 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element j object element j preview editable mall how many post comment shimparam page type actor story 1081832301871428 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1081832301871428 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1081832301871428 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Arthur Henkelhausen Kandida Steger Landesmusikrat Schleswig-Holstein V und anderen gef u00e4llt range offset length entity url www facebook com Landesmusikrat 205726209470058 noncoworker type place aggregatedrange alternate text Dir Arthur Henkelhausen Kandida Steger Landesmusikrat Schleswig-Holstein V und anderen gef u00e4llt range offset length entity url www facebook com Landesmusikrat 205726209470058 noncoworker type place aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1081832301871428 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1081832301871428 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingm equestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1038424702878855 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1038424702878855 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1038424702878855 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadInlineStoryPivotAttachment I686561928065136 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 1m object element 1m preview editable mall how many post comment shimparam page type actor story 1035039823217343 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1035039823217343 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Beate Schl u00fcter Birgitt Schroeder Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange alternate text Dir Beate Schl u00fcter Birgitt Schroeder Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention photo fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg photo 1073741832 1035039823217343 ?type permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1035039823217343 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1035039823217343 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted TooltipData set elem e980dec4 markup d3c2dfe2 elem e980dec4 markup d3c2dfe2 EntstreamAttachmentRelatedShare loadInlineStoryPivotAttachment I686561928065136 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 1r object element 1r preview editable mall how many post comment shimparam page type actor story 1030809773640348 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1030809773640348 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Matthi Rasche Johanne W u00f6hrmann Made Indrayana und anderen gef u00e4llt range aggregatedrange alternate text Dir Matthi Rasche Johanne W u00f6hrmann Made Indrayana und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1030809773640348 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1030809773640348 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1030809773640348 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element 1v object element 1v preview editable mall how many post comment shimparam page type actor story 1020603854660940 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ? 99 und appid und 1020603854660940 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1020603854660940 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Landesmusikrat Hamburg V Landesmusikrat Hamburg Mechthild Schwegmann und anderen gef u00e4llt range offset length entity url www facebook com Landesmusikrat-Hamburg-eV-118502524846413 118502524846413 noncoworker type place aggregatedrange alternate text Dir Landesmusikrat Hamburg V Landesmusikrat Hamburg Mechthild Schwegmann und anderen gef u00e4llt range offset length entity url www facebook com Landesmusikrat-Hamburg-eV-118502524846413 118502524846413 noncoworker type place aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1020603854660940 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1020603854660940 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1020603854660940 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadRelatedLSCVideoAttachment 1031169230309251 true LitestandShareAttachment init elem ode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1081832301871428 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted TooltipData set elem e980dec4 markup d3c2dfe2 elem e980dec4 markup d3c2dfe2 EntstreamAttachmentRelatedShare loadInlineStoryPivotAttachment I686561928065136 EntstreamAttachmentRelatedShare loadInlineStoryPivotAttachment I686561928065136 EntstreamAttachmentRelatedShare loadInlineStoryPivotAttachment I686561928065136 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element preview editable mall how many post comment shimparam page type actor story 1081459031908755 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced null commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1081459031908755 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Paul Breiting Museum der Arbeit Landesmusikrat Hamburg und anderen gef u00e4llt range offset length entity url www facebook com MuseumderArbeit 284395384979279 noncoworker type place aggregatedrange alternate text Dir Paul Breiting Museum der Arbeit Landesmusikrat Hamburg und anderen gef u00e4llt range offset length entity url www facebook com MuseumderArbeit 284395384979279 noncoworker type place aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1081459031908755 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1081459031908755 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment profile action commentlist comment 1081459031908755 ranked threaded range offset length value count clienthasall true replie null featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted UFIController factory elem b8b0125f LegacyMentionsInput react inst markup a0d94362 elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element t object element t preview editable mall how many post comment shimparam page type actor story id ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ?parent fbid und appid und u00255B0 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null defaultcommentorderingmode displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked isshare isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Ralph Kessler Ruth Heume und anderen gef u00e4llt range aggregatedrange alternate text Dir Ralph Kessler Ruth Heume und weiteren Personen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData group message last comment time neighbor membership group set subtext true queryEndpoint typeahead group mention bootstrapData group message last comment time neighbor membership group set subtext true bootstrapEndpoint typeahead group mention bootstrap enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch token messagereplycontext null ownerid permalink permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie showremovemenu true showsendonentertip suggestedreaction null viewercanlike true viewercansubscribetopost true viewerid iscommentprivate comment body text Sch u00f6ne Konzert und sch u00f6ne Preisverleihung range aggregatedrange isfeatured likecount hasviewerliked canremove canreport canedit isauthorweakreference isauthornoncoworker istranslatable viewercanlike true cancomment spamreplycount commentshareuri sharer ? 69 und appid und 142898749490099 und u00255B0 u00255D canembed canEditConstituentTitle 142898749490099 fbid legacyid author ftentidentifier source highlightcomment scrolltopoffset timestamp time text August verbose Samstag August 54 photo comment fbid markupPreview markup a0d94362 profile 100000202894331 100000202894331 name Gerhard Lein firstName Gerhard vanity gerhard lein thumbSrc scontent-fra3-1 fbcdn net c0 32 p32x32 138214386195324 jpg?oh und 58824A1E gender i18nGender type user friend action commentlist comment range offset length value count clienthasall true replie range offset length value count ftentidentifier containerorderingmode featuredcommentlist comment null replie null featuredcommentid null servertime FbFeedAccessible informStoryContentInserted EntstreamAttachmentRelatedShare loadRelatedAttachment 1083762788365010 LitestandShareAttachment init elem a588f507 elem a588f507 UFIController factory elem b8b0125f LegacyMentionsInput react inst elem b8b0125f ftentidentifier source streamingCommentOrderReversed true entstream feedcontext reaction unit data logging data impression info eyJmIjp7Iml0ZW1fY291bnQiOiIxIn19 surface www page home interacted story type session 8694554c1a616131d9262846c54ea8eb fbfeed context true location type pinned post can moderate timeline story profile published from composer story 502 outer object element w object element w preview editable mall how many post comment shimparam page type actor story 1073126026075389 ft location homepage stream INSIDE FEEDBACK FORM true INSIDE FEEDBACK FORM true isPage isSponsored location homepage stream sht true shareablecomment islivestreaming reactionsNuxConfig null mayLogVPV true defaultNumCommentsToExpand isPermalink ownerName Landesjugendjazzorchester Hamburg null actorSelectorConfig null disabledCommentTooltip null shareLinkConfig shareRel dialog shareURI sharer ?parent fbid und 99 und appid und 10154300560736291 und u00255B0 u00255D und u00255B1 u00255D und share source type unknown und feedback source shareNowMenuURI null embedURI null loggedOutLinkConfig showLikeLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context like showCommentLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showShareLink true ajax timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context share showAddComment addCommentAjaxifyURI timeline sign dialog ?next u00253A u00252F u00252Fwww facebook com u00252Fljjohamburg u00252F u00253Ffref u00253Dt und entity und context comment showBling translationDialogURI null showCommentNuxForGroupMallAd showLikeNuxForGroupMallAd groupMallAdsCommentNuxContent Thi a sponsored post which mean people outside thi group may see too along with any reaction and comment fluentContentToken null isLiveVOD enableVODStreamingComment enableVODPinnedComment false mentionsinput inputComponent LegacyMentionsInput react viewoptionstypeobject null viewoptionstypeobjectsorder null addcommentautoflip true disableCSSHiding true feedbackMode expanded feedbackReferrer feedcarded true instanceid pagesize shortenTimestamp true showaddcomment true showshare true actorforpost actorid allowphotoattachment allowvideoattachment allowgifattachment allowstickerattachment arecommentsdisabled cancomment canremoveall canviewerreact commentcount commentcountreduced commentdisablednotice text Die Kommentarfunktion wurde u00fcr diesen Beitrag deaktiviert range aggregatedrange commentsentenceinfo null 1073126026075389 defaultcommentorderingmode ranked threaded displayreaction entidentifier grouporeventid hasunseencollapsed hasviewerliked hasviewercommented hasviewersubscribed infinitescroll isadminviewer iscommentmarkdowneligible isownerpage true isqanda ispublic true isranked true isshare true isthreaded true lastseentime null lcl lti likecount likecountreduced likesentence current text Petra Brodde Marita Seniuk Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange alternate text Dir Petra Brodde Marita Seniuk Landesmusikrat Hamburg und anderen gef u00e4llt range aggregatedrange livepinnedcommentid null lvc mentionsdatasource inst mentionsdatasourcearg maxResult queryData context topic viewer filter page user include fan context rsp mention post fbid queryEndpoint typeahead php bootstrapData rsp mention enabledLocalCache true enabledMergeUid true disableAllCache enforceNewRequestIDUponFetch bootstrapEndpoint endpoint typeahead first degree php data context mention viewer token filter page group app option friend only messagereplycontext null ownerid permalink ljjohamburg post 1073126026075389 permalinkcommentid null replysocialsentencemaxreplie seenbyall seencount sharecount sharecountreduced null sharefbid showfeaturedreplie true showremovemenu showsendonentertip suggestedreaction null 1073126026075389 viewercanlike viewercansubscribetopost viewerid iscommentprivate orderingmode value recent activity selected name Neueste Kommentare Neue und beantwortete Kommentare erscheinen oben value ranked threaded selected true name Top-Kommentare Die relevantesten Kommentare erscheinen oben comment body text u00fcckwunsch und macht draus! range aggregatedrange isfeatured likecount hasviewerliked canremove canreport canedit isauthorweakreference isauthornoncoworker istranslatable viewercanlike function envFlush function for window requireLazy Env window Env envFlush token AXgHBwcDHbgagqlm lhsh nAQEs9p timeslice heartbeat config pollIntervalM idleGapThresholdM ignoredTimesliceName requestAnimationFrame true listenHandler mousemove true listenHandler mouseover true listenHandler mouseout true listenHandler true enableOnRequire shouldLogCounter timeslice categorie react render true reflow DEV CavalryLogger Landesjugendjazzorchester Hamburg Facebook u0040context schema org u0040type Organization name Landesjugendjazzorchester Hamburg require TimeSlice guard function require handleDefine URLFragmentPreludeConfig incorporateQuicklingFragment true hashtagRedirect true BootloaderConfig jsRetrie null jsRetryAbortNum jsRetryAbortTime payloadEndpointURI www facebook com haste-response CSSLoaderConfig timeout modulePrefix BLCS CurrentCommunityInitialData CurrentUserInitialData USER ACCOUNT DTSGInitialData ISB LSD token AVrhMeIG SiteData revision tier push phase pkg cohort PHASED DEFAULT pkg cohort key haste site www mode key rtl vip LinkshimHandlerConfig support meta referrer default meta referrer policy default switched meta referrer policy origin render verification rate link react default hash MAQFRmc6w linkshim host facebook com use rel opener CdnAkamaiDomainsConfig fbcdnhdsvideo-vh akamaihd net fbcdn-creative-a akamaihd net fbcdn-dragon-a akamaihd net fbcdn-external-a akamaihd net fbcdn-gtvideo-a-a akamaihd net fbcdn-gtvideo-b-a akamaihd net fbcdn-gtvideo-c-a akamaihd net fbcdn-gtvideo-d-a akamaihd net fbcdn-gtvideo-e-a akamaihd net fbcdn-gtvideo-f-a akamaihd net fbcdn-gtvideo-g-a akamaihd net fbcdn-gtvideo-h-a akamaihd net fbcdn-gtvideo-i-a akamaihd net fbcdn-gtvideo-j-a akamaihd net fbcdn-gtvideo-k-a akamaihd net fbcdn-gtvideo-l-a akamaihd net fbcdn-gtvideo-m-a akamaihd net fbcdn-gtvideo-n-a akamaihd net fbcdn-gtvideo-o-a akamaihd net fbcdn-gtvideo-p-a akamaihd net fbcdn-iphotos-a-a akamaihd net fbcdn-iphotos-a akamaihd net fbcdn-iphotos-b-a akamaihd net fbcdn-iphotos-c-a akamaihd net fbcdn-iphotos-d-a akamaihd net fbcdn-iphotos-e-a akamaihd net fbcdn-iphotos-f-a akamaihd net fbcdn-iphotos-g-a akamaihd net fbcdn-iphotos-h-a akamaihd net fbcdn-photos-a-a akamaihd net fbcdn-photos-a akamaihd net fbcdn-photos-b-a akamaihd net fbcdn-photos-c-a akamaihd net fbcdn-photos-d-a akamaihd net fbcdn-photos-e-a akamaihd net fbcdn-photos-f-a akamaihd net fbcdn-photos-g-a akamaihd net fbcdn-photos-h-a akamaihd net fbcdn-profile-a akamaihd net fbcdn-sphotos-a-a akamaihd net fbcdn-sphotos-b-a akamaihd net fbcdn-sphotos-c-a akamaihd net fbcdn-sphotos-d-a akamaihd net fbcdn-sphotos-e-a akamaihd net fbcdn-sphotos-f-a akamaihd net fbcdn-sphotos-g-a akamaihd net fbcdn-sphotos-h-a akamaihd net fbcdn-static-a akamaihd net fbcdn-video-a-a akamaihd net fbcdn-video-a akamaihd net fbcdn-video-b-a akamaihd net fbcdn-video-c-a akamaihd net fbcdn-video-d-a akamaihd net fbcdn-video-e-a akamaihd net fbcdn-video-f-a akamaihd net fbcdn-video-g-a akamaihd net fbcdn-video-h-a akamaihd net fbcdn-video-i-a akamaihd net fbcdn-video-j-a akamaihd net fbcdn-video-k-a akamaihd net fbcdn-video-l-a akamaihd net fbcdn-video-m-a akamaihd net fbcdn-video-n-a akamaihd net fbcdn-video-o-a akamaihd net fbcdn-video-p-a akamaihd net fbcdn-vthumb-a akamaihd net fbexternal-a akamaihd net fbstatic-a akamaihd net lookbackvideo1-a akamaihd net lookbackvideo2-a akamaihd net lookbackvideo3-a akamaihd net lookbackvideo4-a akamaihd net lookbackvideo5-a akamaihd net lookbackvideo6-a akamaihd net lookbackvideo7-a akamaihd net lookbackvideo8-a akamaihd net igexternal-a akamaihd net fbmentionslive-a akamaihd net fblive-a akamaihd net fbcdn-static-a-a akamaihd net fbcdn-static-b-a akamaihd net fb-s-a-a akamaihd net fb-s-b-a akamaihd net fb-s-c-a akamaihd net fb-s-d-a akamaihd net fb-l-a-a akamaihd net fb-l-b-a akamaihd net fb-l-c-a akamaihd net fb-l-d-a akamaihd net sampling load error message abort mousemove mouseover mouseout click default min UserAgentData browserArchitecture browserFullVersion null browserMinorVersion null browserName Unknown browserVersion null deviceName Unknown engineName Unknown engineVersion null platformArchitecture platformName Unknown platformVersion null platformFullVersion null domain pixel facebook com WebSpeedExperiment non blocking logger ZeroRewriteRule LinkReactUnsafeHrefConfig null CoreWarningGK forceWarning AsyncRequestConfig retryOnNetworkError logAsyncRequest SessionNameConfig seed ZeroCategoryHeader ServerNonce IRZ pUSUkUiyc-63X0iAPJ ErrorSignalConfig uri error facebook com common scribe endpoint php AccessibilityConfig a11yLogicalGridComponent a11yNewsfeedStoryEnumeration a11yInitialDialogFocusElement true BanzaiConfig EXPIRY MAX SIZE MAX WAIT RESTORE WAIT blacklist time spent boosted component true boosted pagelike true boosted post true boosted website true jslogger true mercury send error logging true page client logging true platform oauth client true useraction true video true visibility true vital true graphexplorer true gql web logging true sync banzai FbtLogger logger null FbtResultGK inlineMode INLINE IntlViewerContext GENDER IntlPhonologicalRule meta !? !? pattern u00dfszx u0001 u0001 u0001 u0001 u0001 ReactGK PageNavigationStageLoggerGK reloadOnBootloadError true FunnelLoggerConfig freq WWW CANVA CREATION FUNNEL WWW CANVA EDITOR FUNNEL WWW LINK PICKER DIALOG FUNNEL WWW MEME PICKER DIALOG FUNNEL WWW LEAD GEN FORM CREATION FUNNEL WWW LEAD GEN DESKTOP UNIT FUNNEL WWW LEAD GEN MSITE UNIT FUNNEL WWW CAMPFIRE COMPOSER UPSELL FUNNEL WWW RECRUITING FUNNEL WWW EXAMPLE FUNNEL WWW REACTION NUX FUNNEL MSITE EXAMPLE FUNNEL WWW FEED SHARE DIALOG FUNNEL MSITE FEED SHARE DIALOG FUNNEL MSITE COMMENT TYPING FUNNEL MSITE HASHTAG PROMPT FUNNEL WWW AWARENES LEARNING NUX FUNNEL WWW CONSTITUENT TITLE UPSELL FUNNEL MTOUCH FEED MISSED STORIE FUNNEL WWW UFI SHARE LINK FUNNEL WWW FUNNEL GAME QUICKSILVER FUNNEL SOCIAL CONVERSION WWW FUNNEL SOCIAL DASHBOARD WWW FUNNEL SRT USER FLOW FUNNEL MSITE PPD FUNNEL default MarauderConfig app version enabled GroupsProductDetailGating tuzi dialog null WWWBase uri www facebook com PhotoSnowliftActionsGating ALLOW MAKE COVER PHOTO BUTTON ALLOW MAKE PROFILE PICTURE BUTTON InitialServerTime serverTime UFIReactionType LIKE ordering NONE reaction name color display name Gef u00e4llt mir deprecated visible true name like type name color f25268 display name Love deprecated visible true name love type name color display name Dankbar deprecated visible true name dorothy type name color f0ba15 display name Haha deprecated visible true name haha type name color f0ba15 display name Juhu deprecated true visible true name yay type name color f0ba15 display name Wow deprecated visible true name wow type name color f0ba15 display name Verwirrt deprecated true visible true name confused type name null color f0ba15 display name Gef u00e4llt mir deprecated visible name toto type name color f0ba15 display name Traurig deprecated visible true name sorry type name color f7714b display name u00fctend deprecated visible true name anger type TypeaheadMetricsConfig gkResult EmojiConfig hasFBEmoji pixelRatio schemaAuth static fbcdn net image emoji php SupportedEmoji emoji FamilyMentionsData allowFamilyName hasAcceptedNUX both video webm video x-ms-wmv video x-msvideo flv video mp4 video quicktime video mpeg video ogv image photo image video webm video x-ms-wmv video x-msvideo flv video mp4 video quicktime video mpeg video ogv VideoUploadConfig videoExtension mov wmv avi mpe mpg mpeg asf mp4 m4v mpeg4 mkv flv vob ogm ogv nsv mod tod dat m2t divx f4v tmp rmvb webm allowMultimedia showMultimediaNUX FileHashWorkerResource url static fbcdn net rsrc php QlzCqbwr69x name FileHashWorkerBundle WebWorkerConfig logging enabled config WebWorkerLoggerConfig evalWorkerURL rsrc php rfukCScFKrW MercuryConfig FluxInternalConfig logOnPreInitAcces warnOnPreInitAcces StickersConfig emoticon name Emoticon isCommentsCapable true max mru sticker mru pack name u00fcrzlich verwendet isMRU true isCommentsCapable true isComposerCapable true isMessengerCapable true isPostsCapable true pack null RelayAPIConfigDefault inst accessToken actorID fetchTimeout graphBatchURI inst graphURI inst retryDelay useXController true xhrEncoding null PresenceInitialData cookiePollInterval cookieVersion serverTime shouldSuppres dictEncode true WorkModeConfig PaddedStickerConfig CanvasToBlobResource url static fbcdn net rsrc php name CanvasToBlobBundle VideoThumbnailConfig defaultThumbnailURL static fbcdn net rsrc php AAqMW82PqGg gif NumberFormatConfig decimalSeparator numberDelimiter minDigitsForThousandsSeparator UFISpamCountImpl module null FlexLayoutConfig a11yFlexLayout BigPipeExperiment preparse content link image pagelet FbtQTOverride override Anmeldung VideoPlayerAbortLoadingExperiment canAbort UFIConfig commentVPVD idle timeout location min duration log min visible size defaultPageSize renderEmoji true renderEmoticon true shouldShowStickerNUX shouldShowVideosInCommentsNux shouldShowMarkdownCommentNUX shouldShowHideConstituentTitleNUX shouldShowOwnerConstituentTitleNUX vpvLoggingTimeout facecastWWWCommentQueueThreshold canPublishLive logChangeOrderingModeUsageSampleRate logCommentsTimespent true logWhetherUFISeen showHashtagTypeahead numberDelimiter reshareedu true logCommentPost logCommentLoad reactActionLink true reactionsHasDirectReactToken reactionsFunnelLogger null reactionsHoverDelay reactionsHoverThreshold reactionsMultilineSocialSentence reactionsDisableMousemoveTrigger true reactionsHasCommentsNux reactionsHasTooltipBreakdown reactionsHasCommentsBling reactionsHasMegaDock reactionsHasPopupDockAnimation reactionsPopupDockAnimationDuration reactionsHasAnimatedVectorDock reactionsHasAnimatedIconsOnHover reactionsHasStaticVectorDock reactionsHasStaticFileVectorDock reactionsHasTheme reactionsTheme null reactionsHasDockSuggestion reactionsHasSuggestedReaction showCommentEmbedOption true alwaysPreviewSticker publicConversationsUnicornWhitelist typingIndicator subscribe showInline showPill fromEveryone allowCommentCountInSocialSentenceRow allowExplicitPagerCount hasCommentTranslationPref translateAllGK showChooseLoveAnimation showChooseLoveTooltip allowSeeMoreLinebreakInLongWordComment true showWebLivePinnedComment showUFICrowdsource new require handle instance inst URI api graphqlbatch inst URI api graphql require TimeSlice lowerDomain URLFragmentPrelude Primer BigPipe Bootloader TimeSlice disableHeartbeat define root true EntfernenWir verwenden Cookie Inhalte personalisieren Werbeanzeigen maßzuschneidern und messen sowie die Sicherheit unserer Nutzer erhöhen Wenn auf unsere Webseite klickst oder hier navigierst stimmst der Erfassung von Informationen durch Cookie auf und außerhalb von Facebook Weitere Informationen zunseren Cookie und dazu wie die Kontrolle darüber behältst findest hier Cookie-Richtlinie FacebookE-Mail-Adresse oder HandynummerPasswortKonto vergessen?Mehr von Landesjugendjazzorchester Hamburg anzeigen indem dich bei Facebook anmeldestSchreibe dieser Seite erfahre mehr bevorstehenden Veranstaltungen und viele mehr Wenn kein Facebook-Konto hast kannst eine erstellen mehr von dieser Seite anzuzeigen AnmeldungAnmeldenMehr von Landesjugendjazzorchester Hamburg anzeigen indem dich bei Facebook anmeldestSchreibe dieser Seite erfahre mehr bevorstehenden Veranstaltungen und viele mehr Wenn kein Facebook-Konto hast kannst eine erstellen mehr von dieser Seite anzuzeigen AnmeldungAnmeldenJetzt nichtBeiträgeAlle anzeigenLandesjugendjazzorchester Hamburg29 August Gestern Fernsehen morgen Radio Wir sind morgen bei TIDE Gast und stellen der Sendung Jazzhau Radio unsere aktuelle NewSound Bigbandkomponisten Deutschland vor Hören kann man die Sendung live über www tidenet deradio August von EUR Uhr Durchwahl Studio streaming tidenet destreaming tidenet deNeue Meldungen von Landesjugendjazzorchester HamburgLandesjugendjazzorchester Hamburg28 AugustFür alle die Fernsehen verpasst haben Jazz-Newcomer erhalten Förderpreisndr de0 KommentareLandesjugendjazzorchester Hamburg28 AugustDa war sehr schön gestern Abend open air vor dem Museum der Arbeit Vielen Dank allen für tolle Feedback! NDR Fernsehen war auch Heute Abend Uhr gibt dort etwa sehen von unserem Konzert und der Preisverleihung durch die Bert-Kaempfert-Stiftung Mehr anzeigen0 KommentareVideosAlle anzeigenHeute hat unsere diesjährige Herbstarbeitsphase begonnen Unter dem Motto New Sound Bigbandkomponisten Deutschland studieren wir noch Freitag Werke von einigen der herausragendsten zeitgenössischen Bigbandkomponisten ganz Deutschland ein für eine Ehre und für großartige Musik! Die Proben sind bereit vollem Gange wie auch folgende Video beweist swingt schon ganz gewaltig zweiten Tag unserer Arbeitsphase Und sieht dann vom Platz unsere Dirigenten Lar Seniuk Stimmung ist gut Unsere Saxophonsection probt mit Johanne Ender Steve Gray What Here For? anzeigenPostsLandesjugendjazzorchester Hamburg29 August Gestern Fernsehen morgen Radio Wir sind morgen bei TIDE Gast und stellen der Sendung Jazzhau Radio unsere aktuelle NewSound Bigbandkomponisten Deutschland vor Hören kann man die Sendung live über www tidenet deradio August von EUR Uhr Durchwahl Studio streaming tidenet destreaming tidenet deLandesjugendjazzorchester Hamburg28 August Für alle die Fernsehen verpasst haben Jazz-Newcomer erhalten FörderpreisSie gehören den besten Jazz-Newcomern Deutschland doch Geld beim Landesjugendjazzorchester ist immer knapp Nun haben sie einen Förderprei von Euro erhalten ndr deVon NDRLandesjugendjazzorchester Hamburg hat Gerhard Lein Beitrag geteilt August war sehr schön gestern Abend open air vor dem Museum der Arbeit Vielen Dank allen für tolle Feedback! NDR Fernsehen war auch Heute Abend Uhr gibt dort etwa sehen von unserem Konzert und der Preisverleihung durch die Bert-Kaempfert-Stiftung Gerhard Lein hat neue Foto hinzugefügt August Hoffest MdA Hamburg mit Konzert Hamburg hat eine Veranstaltung hinzugefügt August bei Barmbek SchwingtSa UTC Bert-Kaempfert-Platz Hansestadt Hamburg Deutschland17 Personen sind interessiert Personen nehmen teilLandesjugendjazzorchester Hamburg hat Jazz Hamburg Beitrag geteilt August Wir freuen sehr das nach dem Bundesjazzorchester und der Band Yo! Jazz nun Landesjugendjazzorchester Hamburg Preisträger Förderpreise der Bert-Kaempfert-Stiftung ist Jazz Hamburg16 August wir gratulieren! www kultur-port deEUR Landesjugendjazzorchester Hamburg LJJO Hamburg erhält den Förderprei der Bert-Kaempfert-StiftungDem LJJO Hamburg Spitzenensemble der Hamburger Jazznachwuchsförderung wird Samstag dem August Uhr Rahmen der Veranstaltung EURBarmbek SchwingtEUR der Förderprei derkultur-port deLandesjugendjazzorchester Hamburg9 August und schon bald gibt LJJO wieder live hören spielen wir nicht nur ohne Eintritt und unter freiem Himmel bei Barmbek Schwingt Stücke der aktuellen und unsere aktuellen Programm wir freuen auch sehr darüber den Förderprei der Bert-Kaempfert-Stiftung verliehen bekommen August Uhr vor dem Museum der Arbeit Barmbek www museum-der-arbeit deEUR veraEUR barmbek-schwingt htmMuseum der ArbeitOb Druckerei Handelskontor Metallwerkstatt oder Sonderausstellun museum-der-arbeit deLandesjugendjazzorchester Hamburg18 Juli Ein Tag voller spannender Probespiele geht vorüber Vielen Dank allen BewerberInnen war eine Freude | | ljjo-hamburg.de
Sex xXx fick Erotik sexy hardcore

Medien Nachrichten Informationen Aktuelle Journalismus Presse Fotos Kultur Online Zeitungen Reisen RSS Feeds News Stadt Fernsehen Auszeichnungen Digitales Einschaltquoten Fernsehprogramm Film Infos Internet Kabelfernsehen Satellitenempfang Sender Pay Sendungen Comedy Fahrzeuge Infotainment Reality Soap Talkshows Tiere Sonstiges Videotext Medienproduktion Game Radio Ton Webradio Radiosender House Pop Jazz Blues Wetter Zensur Kontrolle Thema Arbeit Beruf Karriere Bildung Schulen Unterricht Uni Druck Printmedia Druckerei Event Party Veranstaltungsservice Geld Börse Finanzen Handy Telefon Haus Heim Garten Kunst Antiquitäten Menschen Vereine Communitys Gruppen Treffs Multimedia Unterhaltungselektronik Technik Musik Musikszene Private Webseiten Schmuck Uhren Accessoires Sparen Spenden Hilfe Entwicklung Top Marken Labels Versicherungen Welt Frau Männer Werbung Marketing Promotion Weitere FanWebseiten Rente Vorsorge Leben | Landesjugendjazzorchester Hamburg Gef und xe4 llt 437 Mal und xb7 43 Personen sprechen dar und xfc ber Das Landesjugendjazzorchester Hamburg vereint und f und xf6 rdert die |
1. PR-Navi.de ljjo-hamburg.de
2. PR-Navi.de ljjo-hamburg.de

|
Listings werden von dritter Seite automatisch generiert und stehen weder mit dem Domaininhaber noch mit dem Dienstanbieter in irgendeiner Beziehung Sollten markenrechtliche Probleme auftreten wenden Sie sich bitte direkt an den Domaininhaber welcher aus dem Whois ersichtlich wird Privacy Policy gaq push setAccount UA-48689684-1 gaq push setDomainName auto gaq push setAllowLinker false gaq push setCustomVar 1 Theme CleanPeppermint 1 gaq push setCustomVar 2 Theme Type two 3 gaq push setCustomVar 3 Category ID 0 3 gaq push setCustomVar 4 Colorscheme 3 gaq push setCustomVar hInputBorder 5 hideSearchInputBorder true tcblock Required and steady container tc type relatedsearch number 10 Ad Icon adIconUrl afs googleusercontent comdp-teaminternetarr f9c826 png adIconWidth 17 adIconHeight 12 adIconSpacingAbove 11 adIconSpacingAfter 17 Font-Sizes and Line-Heights fontSizeTitle 22 fontSizeAttribution 14 lineHeightTitle 33 Colors colorBackground transparent colorTitleLink 2C5096 rolloverLinkColor F9C826 colorAdSeparator 264f99 Alphabetically noTitleUnderline true titleBold true verticalSpacing 3 webFontFamily Libre Baskerville 666px isAdult false xb l location host location pathname location search ? location search und ? xafvr ZjNiM2IxMDZhYTQ0MTk1NmE4ZmJjMjgyYjQxYjliYTBjNzk5NTg2Myw1N2NkMWM3MGU1ODFl if !window JSON document write x pageOptions resultsPageBaseUrl www ljubljana de?ts fENsZWFuUGVwcGVybWludHx8ZjgyNTJ8YnVja2V0MDA3fHx8fDB8fDU3Y2QxYzcwZTMzYjZ8fHwxNDczMDU5OTUzLjEwNDJ8MTU2ZDQwNTBmODRiZGZjYjQyZTAxMGM0MGRhYjAxMjVjNDM3NjAwYnx8fHx8MXx8fDB8NTdjZDFjNzA4ZDY1MTBkMDMxOGI2ODhlfHx8MXx8fHx8MHwwfHx8fHx8fHx8 hl de kw terms uiOptimize true channel bucket007 pubId dp-teaminternet12 3ph adtest off clicktrackUrl track parking 5 domty ascii 3 gaq push gat anonymizeIp gaq push trackPageview ga document createElement script ga type textjavascript ga async true ga src https document location protocol ? https ssl www google-analytics comga js s document getElementsByTagName script 0 s parentNode insertBefore ga s searchboxBlock Required and steady container searchbox type searchbox Font-Sizes and Line-Heights fontSizeSearchInput 12 fontSizeSearchButton 13 Colors colorSearchButton f8ec58 colorSearchButtonText 2c5096 colorSearchButtonBorder transparent Alphabetically heightSearchInput 22 radiusSearc ljubljana de SendOffer offer window open www parkingcrew netsale form php?domain name ljubljana de pcrew offer left top screen ? 20 100 menubar no status yes toolbar no scrollbars yes Diese Domain kaufen ljubljana de showImprint imprintwnd window open pcrew imprint 640 480 left top menubar no status yes toolbar no imprintwnd document writeln ImpressumVipex Media Services GmbHBrüsseler Str 2150674 KölnGeschäftsführer Jörg TiemannUmsatzsteuer-Identifikationsnummer USt-IdNr DE 239391480HRB Köln Nr 54288Gerichtsstand KölnFon 0221 992255-0Fax 0221 992255-22E-Mail welcome vipe ase 57cd1c708d6510d0318b688e sbtext Suchen xt auto load 0 ads pop cats rxid 0 uniqueTrackingID MTQ3MzA1OTk1Mi45MzY6ZmFkMzg5NWFlNGMzZWM4MDI3MDRlZDY0ZmIzYmU4NDY2ODFlYTAwMGQyYzllYzlkMzE1YTdiNDkzMGIxODMzZjo1N2NkMWM3MGU0ODZj search is afs false country de themedata fENsZWFuUGVwcGVybWludHx8ZjgyNTJ8YnVja2V0MDA3fHx8fDB8fDU3Y2QxYzcwZTMzYjZ8fHwxNDczMDU5OTUyLjk0fDBhNGJmNzZlNTJjYWEwOTA1NGVmY2Y2N2NjOTA3NzFjMWYyMDdhOTN8fHx8fDF8fHwwfHx8fDF8fHx8fDB8MHx8fHx8fHx8fA domain ljubljana de scriptPath adtest off useFallbackTerms false if top location! location top location href location protoco x deMit Urteil vom 12 Mai 1998 hat das Landgericht Hamburg entschieden dass man durch die Ausbringung eines Links die Inhalte der gelinkten Seite ggf mit zu verantworten hat Dies kann - so das LG - nur dadurch verhindert werden dass man sich ausdrücklich von diesen Inhalten distanziert Auf diesen Seiten sind Links zu anderen Seiten im Internet gesetzt bzw wird es Besuchern ermöglicht selbst Links einzutragen Für all diese Links gilt dass wir keinerlei Einfluss auf die Gestaltung und die Inhalte der gelinkten Seiten haben Deshalb distanzieren wir uns hiermit ausdrücklich von den Inhalten all dieser verlinkten Seiten Diese Erklärung gilt auch für Inhalte unserer Seiten welche durch Besucher gestaltbar oder veränderbar sind imprintwnd document close showPolicy link www parkingcrew net policywnd window open link privacy html pcrew policy 890 330 left top menubar no status yes toolbar no policywnd focus showAboutUs link document location host aboutus php?domain ljubljana de policywnd window open link pcrew policy 890 330 left top menubar no status yes toolbar no policywnd focus Imprint 2016 All Rights Reserved Die hier angezeigten Sponsored crew nettrack php?click caf und domain ljubljana de und rxid 0 und uid MTQ3MzA1OTk1Mi45MzY6ZmFkMzg5NWFlNGMzZWM4MDI3MDRlZDY0ZmIzYmU4NDY2ODFlYTAwMGQyYzllYzlkMzE1YTdiNDkzMGIxODMzZjo1N2NkMWM3MGU0ODZj und ts fENsZWFuUGVwcGVybWludHx8ZjgyNTJ8YnVja2V0MDA3fHx8fDB8fDU3Y2QxYzcwZTMzYjZ8fHwxNDczMDU5OTUzLjEwNDJ8MTU2ZDQwNTBmODRiZGZjYjQyZTAxMGM0MGRhYjAxMjVjNDM3NjAwYnx8fHx8MXx8fDB8NTdjZDFjNzA4ZDY1MTBkMDMxOGI2ODhlfHx8MXx8fHx8MHwwfHx8fHx8fHx8 und adtest off x pageOptions domainRegistrant as-drid-2648594922701728 loadFeed if typeof formerCalledArguments ! undefined und false formerCalledArg uments arguments query arguments if typeof formerCalledArguments object query formerCalledArguments return google ads domains Caf apply this query relatedCallback options return false relatedFallback callback return callback if typeof x undefined typeof pageOptions undefined links document head getElementsByTagName link for i 0 i links length i links i href links i href replace d32ffatx74qnju cloudfront net parkingcrew netassets document body style visibility visible document getElementById searchHolder style visibility hidden new loadFeed pageOptions tcblock searchboxBl | Sex xXx fick Erotik sexy hardcore | ljubljana.de | | | sex
1. ljubljana.de PR-Navi.de
2. PR-Navi.de ljubljana.de

Sex xXx fick Erotik sexy hardcore | |
Kfz Automobile Zubehör Car Sparen Versicherungen Krankenversicherungen Tier | gekennzeichnete Felder sind Pflichtfelder Alle Artikel EUR Details Weihnachten mit WALLACE GROMIT und Geschenkbox Mail British Royal Mint Collector Stempel Ausgabedatum November Design Aardman Animations Ltd und Royal Mail Drucker Rue Print Sicherheit Neuware WALLACE GROMIT und mit Geschenkbox Royal Mail Mint Stamps British Collector Weitere Informationen Datum Stempel November Design Aardman Animations Ltd und Royal Mail Drucker Rue Sicherheitsdr aby EUR Details Allianz Gegen die Dummheit Ausgabedatum Audio Records Soulfood EUR Details Best Daniel Taylor Ausgabedatum Audio Atma in-akustik EUR Details Chakra Yoga Ausgabedatum Audio SchröderMedia HandelsgmbH EUR Details Disney Piano Ausgabedatum Audio Baby ComIndys EUR Details Direction for Children Ausgabedatum Audio Baby ComIndys EUR Details Little Sister Band Ausgabedatum Audio Baby ComIndys EUR Details Grimms Märchen Schneewittchen Tischl ein deck dich Ausgabedatum Audio Euro Trend MCP Sound und Media EUR Details fröhliche Die Geschichte eines wunderbaren Liedes Ausgabedatum Audio cap-music EUR Details The Songs Mathilde Rothschild Ausgabedatum Audio Nimbus Naxos Deutschland Musik und Video Vertriebs- EUR Details Jetzt nicht denken Ausgabedatum Audio Escalate Rec EUR Details San Carlos Ausgabedatum Audio Baby ComIndys EUR Details Time Pieces for Piano Ausgabedatum Audio Pid EUR Deta ndys EUR Details Beste Van Ausgabedatum Audio Telstar Het Beste Van EUR Details Bob Marley Joint Fridge Magnet Kühlschrank Magnet Ausgabedatum Zubehör Sales EUR Details Fürchtet Euch nicht! Ausgabedatum Audio Artmode-Records EUR Details Sacrificio Dama Ausgabedatum Audio Mis EUR Details Best Key West Ausgabedatum Audio Baby EUR Details Riding Bike Ausgabedatum Audio CYP Limited EUR Details Eine Deutsche Messe Ausgabedatum Audio Genuin Note Musikver Ljms suchen Toggle navigation Startseite Vergleichsrechner Strom Gas DSL Mobilfunk Krankenversicherung Lebensversicherung KFZ Versicherung Hilfe Erweiterte Suche Sortieren nach Relevanz Ersparnis Preis aufsteigend Preis absteigend Anbieter Trefferanzahl 20 Preis einschränken Nur ohne Lieferkosten Nur sofort Lieferbar Newsletter Melden Sie sich jetzt und erhalten Sie regelmäßig Informationen über neue Produkte Sonderangebote oder neue Gutscheine Mit uck Neu Geschenkverpackung EUR Details Blutiger Finger Abgehackter Kunststofffinger Täus Ausgabedatum Zubehör Close EUR Details Aufblasbare Luftgitarre Gitarre aus Kunststoff Ausgabedatum Zubehör Close EUR Details Kugelschreiber Spritze aus Kunststoff mit Roter Ausgabedatum Zubehör Close EUR Details Haugtussa und Deutsche Lieder Ausgabedatum Audio Simax Naxos Deutschland Musik und Video Vertriebs- EUR Details Buena Mala Ausgabedatum Audio Baby ComI ser Harmoniemusikbesetzung Ausgabedatum Audio Musikmuseu Note Musikvertrieb EUR Details Book Redemption the Ausgabedatum Audio Baby ComIndys EUR Details Het Mooiste Van Ausgabedatum Audio Ccm EUR Details Von Null auf Hundert! Ausgabedatum Audio Tyrolis Music Tyrolis EUR Details Walking With Dinosaurs Ausgabedatum Audio Red River rough trade 20 EUR Details Beacon Ausgabedatum Audio Baby ComIndys EUR Details Solo und String Banjo Ausgabedatum Audio B ndys EUR Details Husar Guardia Ausgabedatum Audio Novoson EUR Details Esclava Piel Ausgabedatum Audio Import Sony BMG EUR Details Guitar Bass Drums Ausgabedatum Audio Baby ComIndys EUR Details Letters And Words With Garfield Ausgabedatum Audio ESP International NuSpring Kids EUR Details The War Sea Ausgabedatum Audio Cd41 Namskeio distribution EUR Details One Game Wonder Ausgabedatum Audio Pid EUR Details Masters Guitar Ausgabedatum Audio Baby ComI ils Die besten Märchen von Hans Christian Andersen Ausgabedatum Audio Lamp und Leute Universal Music EUR Details Fil ariadna Ausgabedatum Audio Blanco Negro EUR Details Powers That Ausgabedatum Audio Mis EUR Details Five Stringed Tenor Viola Ausgabedatum Audio Lotus Reco Harmonia Mundi EUR Details Der Kodex von Staffarda Jahrhundert Ausgabedatum Audio E EXTRAPLATTE Musikproduktion Impressum Inkl MwSt ggf zzgl Versand zwischenzeitliche Änderung mögl trieb EUR Details Evil and Flowers Paper Sleeve Ausgabedatum Audio Mis EUR Details Voice Training Cds Ausgabedatum Audio Baby ComIndys EUR Details Foot the Pedal Ausgabedatum Audio Baby ComIndys EUR Details Calypso Rock Songs Jamaica Ausgabedatum Audio Folkways Records EUR Details Bye Lady Ausgabedatum Audio smurecords EUR Details Times Table Challenge Ausgabedatum Audio CYP Limited EUR Details Requiem Aeternam Sakralmusik der Frühromantik mit gros

| ljms.de
1. PR-Navi.de ljms.de
2. PR-Navi.de ljms.de

| 1px label position absolute label height label width label overflow hidden Make sure the email value filled before allowing submit form getElementById subscribe-blog-blog subscription-2 input getElementById subscribe-field-blog subscription-2 handler event input value input focu if preventDefault preventDefault false window form submit handler else form onsubmit handler LJRT-Projektseiten Better Juleica Thüringen Kompetenznachwei Ehrenamt Wahlblog Yougend com Landesjugendring Thüringen e Impressum Top stq window stq push view ext 1 3 blog post tz srv ljrt stq push 48514779 gaq push setAccount UA-39472945-1 gaq push function document script type ga async true src document location ? ssl www google-analytic comga document script parentNode insertBefore ttbewerbe Menschen und Erfolge Foto menschenunderfolge Unter dem Motto und Ländliche Räume produktiv und innovativ und widmet sich der Wettbewerb und Menschen und Erfolge und in diesem Jahr den wirtschaftlichen Perspektiven für ländliche Räume Weiterlesen und rarr September Kategorie Familienprei 2016 Foto stiftung-familiensinn Die Stiftung FamilienSinn lobt den Familienprei 2016 unter dem Motto und Miteinander der Generationen und au Jetzt Bewerbungen bi zum 10 einreichen Weiterlesen und rarr September Kategorie Förderung Einreichung Konzepte außerschulische Jugendbildung Da Thüringer Ministerium für Bildung Jugend und Sport vertreten durch die Abteilung Kinder Jugend Sport und Landesjugendamt macht Rahmen der Umsetzung de Landesjugendförderplane 2017 b medienprei Event Wettbewerbe Die und Da Gema Gesamtvertrag Austausch Job Juleica Termine Juleica Schulungen Kontakt Impressum use strict masterslider f498 new slider control masterslider f498 control bullet autohide overVideo true dir align bottom margin masterslider f498 control autohide true overVideo true dir inset true align top color margin width slider setup f498 setup MS57e28578ef498 960 250 0 space start grabCursor true swipe mouse true layout boxed wheel autoplay true instantStartLayer false loop true shuffle true preload heightLimit true false true endPause overPause true fillMode fill centerControl true startOnAppear layersMode center hideLayer false fullscreenMargin speed dir parallaxMode swipe view fade window instance push f498 Kategorie We i 2021 zur Durchführung von Angeboten der außerschulischen Jugendbildung Thüringen eine Zuwendung bekannt Weiterlesen und rarr September Kategorie Jugendpolitik Konferenz der Landesjugendringe Erfurt 19 September trafen sich VertreterInnen au allen Landesjugendringen der Bundesrepublik Deutschland Erfurt zur jährlichen Konferenz der Landesjugendringe Weiterlesen und rarr September Kategorie Förderung Jugend-E-Partizipationsprojekte Foto euthproject Reiche Deinen Projektvorschlag ein Nutze und OPIN und erhalte 000 EUR hast eine Idee für ein E-Partizipationsprojekt mit Jugendlichen und brauchst Unterstützung? Dann mach mit und verwirkliche Deine Projektidee! Weiterlesen und rarr September Kategorie Job ProjektleiterIn Schülerzeitungsredaktionen Der LJR Mec text-decoration line-through site-header a site-header color body background-color Landesjugendring Thüringen e AG Thüringer Kinder- und Jugendvertretungen Menü Zum Inhalt springen Da sind wir! LJRT Mitgliedsverbände Vorstand Geschäftsstelle Positionen und Beschlüsse Stellungnahmen Kompetenznachwei im Jugendverband Jugendhilfe Landesjugendhilfeausschus Förderung Antragsverfahren Jugendverbände Landesrichtlinien Landesprogramme Jugendpolitik Thüringer Landtag Jugendhilfe Anfragen den Thüringer Landtag Rechtsextremismu Anfragen den Thüringer Landtag Schule Anfragen den Thüringer Landtag Thüringen-Monitor Publikationen Netz entdeckt Projekte Better Deutsch-Japanische Austauschprogramm Freiwillige Soziale Jahr Jugendgeschichtstag Werte Zusammen Leben Yougend hlgefährdung Kultur Landesjugendförderplan LJRT Migration Partizipation Pressemitteilungen Projekt LJRT Regierungsprogramm Stellenangebote Stipendium Strukturierter Dialog Thüringen Vollversammlung Werte Zusammen Leben Werteprojekt Wettbewerb yougendmedienprei LJRT-ArchivDokumentenarchiv Downloadbereich window gcfg lang function document script type po async true src api google j document script parentNode insertBefore via E-Mail neue Benachrichtigungen abonnieren Geben Sie Ihre E-Mail-Adresse um Benachrichtigungen über neue Beiträge via E-Mail erhalten E-Mail-Adresse Custom for safari and function In case the placeholder i available remove label if placeholder d input label querySelector label for subscribe-field-blog subscription-2 label clip rect 1px Einreichung Konzepte außerschulische Jugendbildung Konferenz der Landesjugendringe Erfurt Jugend-E-Partizipationsprojekte ProjektleiterIn Schülerzeitungsredaktionen Ausschreibung soziokulturelle Projekte Frauen Kultur macht stark LJRT-Da sind wirWir über un LJRT Mitgliedsverbände Vorstand Geschäftsstelle Positionen und Beschlüsse Stellungnahmen Projekte LJRT-Antragsverfahren LJRT-ThemenAuslandsaufenthalte Austauschprogramme Berufseinstieg Better Bildung Demografie Demokratie Ehrenamt Europa Europawahl Extremismu Fachtagung Ferienfreizeit Flüchtlinge Fortbildungsprogramm Freiwillige Soziale Jahr Förderung Inklusion Integration Jugendgeschichtstage Jugendprei Jugendprojekte Jugendschutz Jugend und Politik Jugendverbandsarbeit Juleica Kinderschutz Kindeswo klenburg-Vorpommern sucht zum 10 einen ProjektleiterIn zur Unterstützung von Kindern und Jugendlichen beim Aufbau und bei der Arbeit von Schülerzeitungsredaktionen Vollzeit Stunden pro Woche Weiterlesen und rarr September Kategorie Förderung Ausschreibung soziokulturelle Projekte Foto fonds-soziokultur Offene Ausschreibung für soziokulturelle Projekte und Raue Zeiten und Der Fond Soziokultur sucht wieder Menschen mit kreativen Ideen und Niveau Zur Diskussion stehen die Themen de Klimawandel die Frage der Flüchtlinge Suche nach bezahlbarem Wohnraum wachsende Ungleichheit Folgen von Freihandel und Globalisierung Weiterlesen und rarr September Kategorie Förderung Frauen Kultur macht stark Foto frauen-id Förderung von Kulturmaßnahmen für geflüchtete junge Fr auen Da Paritätische Bildungswerk fördert al Verband unter dem Titel und Frauen und Bündnisse für Bildung die kulturelle Projekte für geflüchtete junge Frauen zwischen und Jahren durchführen Weiterlesen und rarr September Beschlüsse LJHA vom 09 60-16 Fachliche Empfehlungen für Thüringer Eltern-Kind-Zentren Fachliche Empfehlung zur Gestaltung und Sicherung der Verfahren zur Beteiligung und Beschwerde Kindertageseinrichtungen Handlungsleitlinien für Kinderschutzkonzepte zur Prävention und Intervention Kindertageseinrichtungen Landesjugendförderplan und 2021 Leseexemplar September 123456782030 Suche nach Verbindung bleiben Projekt Werte Zusammen Leben Projektaktivitäten Logo zum Download Projekte LJRT-Aktuelle Beiträge Menschen und Erfolge Familienprei 2016 Landesjugendring Thüringen e Thüringer Kinder- und Jugendvertretungen context schema org type website url ljrt name Landesjugendring u00fcringen e potentialAction type ljrt ? search term string query-input required name term string window baseUrl w org image core emoji 72x72 ext png svgUrl w org image core emoji svg svgExt svg source concatemoji ljrt wp-include j wp-emoji-release min js?ver 6 !function b function a d e g b canva i getContext und getContext j String fromCharCode !i!i fillText return!1 switch textBaseline top font 32px Arial case return fillText 55356 55356 0 ! toDataURL length download-info download-button url ljrt gif download-info more-button url ljrt gif grabbing curosr ljrt cur grab curosr ljrt cur img wpstat display none broken link |
Sex xXx fick Erotik sexy hardcore
ljrt.de
sex

Der Landesjugendring Th ringen ist ein Partner wenn es um die politische Interessenvertretung von Kindern und Jugendlichen im Freistaat Th ringen geht | 1. PR-Navi.de ljrt.de
2. ljrt.de PR-Navi.de



ljt.de | sex

size font-weight bold content-webarchive div webarchive-block float left margin-right margin-bottom content-webarchive div webarchive-block font-weight bold content-webarchive div webarchive-block link content-webarchive div webarchive-block visited text-decoration none content-webarchive div webarchive-block active content-webarchive div webarchive-block focus content-webarchive div webarchive-block hover text-decoration underline content-webarchive div webarchive-block none inside content-webarchive div webarchive-block margin-top padding-top buybox-content buybox-salesbadge-content margin paddin solid -webkit-box-shadow box-shadow word-wrap break-word float right buybox-content buybox-salesbadge-content font-size !important color fff buybox-content link buybox-salesbadge-content link buybox-content active buybox-salesbadge-content active buybox-content visited buybox-salesbadge-content visited text-decoration none buybox-content hover buybox-salesbadge-content hover text-decoration underline buybox-content buybox-salesbadge-content text-align center display block text-transform uppercase buybox-content buybox-salesbadge-content font-weight bold buybox-content buybox-salesbadge-content font-size text-align center margin-top buybox-content buybox-salesbadge-content font-weight normal buybox-salesbadge-content margin paddin text-align center buybox-salesbadge-content seal url sedoparkin comtemplatesbrick gfx1019seal no-repeat margin auto buybox-salesbadge-content button display inline-block solid CCCCC paddin -webkit-gradient linear left top left bottom from -webkit-linear-gradient top -o-linear-gradient top linear-gradient buybox-salesbadge-content button hover buybox-salesbadge-content button active buybox-salesbadge-content button focus cursor buybox-salesbadge-content button color font-size font-weight bold text-transform uppercase text-decoration none paddin url sedoparkin comtemplatesbrick gfx1006bullet lime gif no-repeat -5px transparent buybox-salesbadge-content button hover buybox-salesbadge-content button active buybox-salesbadge-content button focus color E5792 container-salesbadge float left display inline buybox-vertical-content paddin solid fff -webkit-gradient linear left top left bottom color-stop -webkit-linear-gradient top -o-linear-gradient top linear-gradient text-align center buybox-vertical-content display inline font-size buybox-vertical-content text-align center buybox-vertical-content padding-right text-transform uppercase buybox-vertical-content span font-size !important font-weight bold color eee buybox-vertical-content link buybox-vertical-content active buybox-vertical-content visited color eee text-decoration none buybox-vertical-content hover text-decoration underline container-content -webkit-box-shadow box-shadow content-relatedlinks -webkit-box-shadow box-shadow container-footer color eee container-footer color eee domain color container-relatedlinks span color container-relatedlinks link container-relatedlinks visited color container-relatedlinks hover container Price domainCurrency EUR www ljt dnsh true dpsh true toSell true tid oneclick buybox true buyboxTopi true disclaimer true imprint true noFollow toSellUrl www sedo details ?partnerid und language und cid und lid und domain ljt und sub und origin parkin www ljt parkin php ses gts toSellText info domcollect com INT imprintUrl www domcollect com contact-us rlStrategy contentType content pus ses postActionParameter feedback php?ses token logErrorCode gFeedSES default alternate jsParameter request pubId dp-sedo93 domainRegistrant as-drid-2819866878916816 adtest off noAds uiOptimize true channel exp-005 auxa-control- alternate pubid dp-sedo93 adult ads adv advt rlRequestMode jsonp rlbox rlUrl waUrl portal php?l true tscQs und ses und MjEzMzI3NzY0 und NzguNDkuNzIuOTY und d5d9e5e9ab428eb2080a909f1eea7bb7d8ec63bb und rlSes ses lan maid sedoParkingUrl www sedo com parkin php3?language und partnerid signedLink visitorViewId i18n BUYBOX BROKERAGE Diese Domain u00f6nnte zum Verkauf stehen! BUYBOX FULL Diese Domain ist verkaufen BUYBOX INQUIRE Anfragen BUYBOX TEASER NOPRICE Sie u00f6nnen die Domain domainName kaufen! BUYBOX TEASER PRICE Sie u00f6nnen die Domain domainName u00fcr domainPrice domainCurrency vom Inhaber kaufen BUYBOX TOPI Domain erwerben FOOTER DISCLAIMER Die auf dieser Seite automatisiert bereitgestellten Werbeanzeigen kommen von dritter Seite und stehen mit Domain-Inhaber oder Sedo keiner Beziehun FOOTER DOMAIN APPRAISAL Domain-Bewertun FOOTER DOMAIN AUCTION Domain-Auktion FOOTER DOMAIN BUY Domain suchen FOOTER DOMAIN ESCROW Domain-Umzu FOOTER DOMAIN MAIN Domainnamen FOOTER DOMAIN PARKIN Domain-Parkin FOOTER DOMAIN Domains verkaufen FOOTER DOMAIN SELL Domain anbieten FOOTER DOMAIN TOP Top-Domains FOOTER REGISTRAR INFO Sind Sie der Domain-Eigent u00fcmer und u00f6chten wissen wieso diese Domain anders als die anderen geparkten Domains aussieht? FOOTER REGISTRAR INFO LINK Infos hier FOOTER REGISTRAR INFO TEASER Diese Domain ist entweder nicht korrekt auf die Sedo-Domain-Parkin URL weitergeleitet oder noch nicht die Sedo-Datenbank worden Bitte u00fcberpr u00fcfen Sie die Weiterleitun und tragen Sie diese Domain erst Ihrem Kundenmen u00f ein! FOOTER TEASER Diese Webseite wurde vom Domain Inhaber dynamisch generiert der das Sedo Domain Parkin Programm nutzt LANGUAGE Sprache POPULAR CATEGORIES Beliebte Kategorien Privacy Policy TXT usin our site you consent this privacy policy This website allows third-party advertisin companies for the purpose reportin website traffi statistics advertisements click-throughs and other activities use Cookies and Web Beacons and other monitorin technologies serve ads and compile anonymous statistics about you when you visit this website Cookies are small text files stored your local internet browser cache Web Beacon often-transparent graphi image usually larger than pixel that placed Web site Both are created for the main purpose helpin your browser process the special features websites that use Cookies Web Beacons The gathered information about your visits this and oth dust typeof define und define amd und define amd dust und define require dust core onLoad typeof define und define amd und define amd dust !0?define dust core object typeof exports?module exports require dust this INFO b? lo Deprecation warnin is deprecated and will removed future version dustjs-helpers WARN null For help and deprecation timeline see github replace WARN stack tail und stack tail head undefined typeof stack tail head select und get select stack head rebase stack und stack tail und stack tail isPendin isResolved isDeferredComplete deferreds for push select push stack index stack isDeferredPendin deferreds length for isDeferredComplete deferreds length deferreds isDeferredPendin typeof b?b toStrin replace ngm replace gm replace i j block p isResolved und isDeferredPendin hasOwnProperty key No key specified WARN key typep type k resolve value ? isPendin i p isPendin und render i und isResolved o und render switch und toLowerCase case number case Strin case boolean a?! Boolean case date new Date tap resolve sep block stack index stack of-1? d?d first stack index? block last stack index stack of-1? block contextDump i resolve key switch case full stack break default stack head switch JSON stringify i case console contextDump break default replace lte gt gt gte any g? isDeferredComplete?b any Must not nested inside any none block ERROR map deferreds push isResolved und render block end any Must used inside select block ERROR none g? isDeferredComplete?b none Must not nested inside any none block ERROR map deferreds push isResolved render block end none Must used inside select block ERROR size key resolve key und h! isArray length !isNaN parseFloat und isFinite else object typeof for hasOwnProperty und else length write for helpers w register ads 1tier dustBody dust w get SPONSORED LINKS s get ads block w w get line w get line2 get line3 w get visible url w register ads 2tier dustBody dust w eq block key get buyboxTopi value true type boolean w get s get block w w get register webarchive bootstrap dustBody dust w get POPULAR CATEGORIES s get webArchive block w w ? get pus s und category get u w und keyword get u w get s get block w w get register webarchive stati dustBody dust dto ct mappin dto ct mappin oneclick dto ct mappin webarchive dto ct mappin 3 webarchive dto ct mappin 5 twoclick dto ct mappin oneclick dto ct mappin webarchive dto ct mappin twoclick domIsReady attachEvent undefined typeof attachEvent? ie not-ie und typeof und ie ? addEventListener DOMContentLoaded attachEvent onreadystatechange complete readyState? void domIsReady switch body dto advt case push onet break case push twot undefined typeof dto contentType und push dto ct mappin dto contentType undefined typeof dto und push dto length 1? addClass join addClass window domIsReady dust helpers columnSplit Math ceil lengthd columns index und f! length dust helpers showRelatedLinks 0! Object keys stack head rls length loadRls url dto rlUrl und num method GET dataType dto rlRequestMode success void und void length content er websites are used these third party companies order provide advertisements about goods and interest you The information not include any personal dat like your name address email address telephone number you would like more information about this practice and know your choices about not havin this information used these companies click here REGISTRAR FAQ CLICKTEXT Infos hier REGISTRAR FAQ TEXT Sie sind der Domain-Eigent u00fcmer und u00f6chten wissen wieso diese Domain anders als die anderen geparkten Domains aussieht? RELATEDLINKS TOPI Weitere Links Suche SPONSORED LINKS Sponsored listings TITLE Informationen zum Them keywordStrin TITLE TOSELL Diese Website steht zum Verkauf! TOSELL TEASER Die Domain wird vom Inhaber zum Verkauf angeboten TOPI Suche WELCOME CATEGORY domainName ist Ihre erste und beste Informationsquelle u00fcber keywordStrin Hier finden Sie auch weitere interessante Links Wir hoffen dass Sie bei Ihrer Suche erfolgreich sind! WELCOME NOCATEGORY domainName ist die beste Quelle u00fcr alle Informationen die Sie suchen Von allgemeinen Themen bis hin speziellen Sachverhalten finden Sie auf domainName alles Wir hoffen dass Sie hier das Gesuchte finden! cafEl met layoutTypes caf container nessie type ads lines blank true verticalSpacin afs comdp-sedobullet lime gif colorTitleLink colorText C1C1C colorDomainLink C9EC6 titleBold true rolloverLinkColor E5792 rolloverLinkUnderline true met layoutTypes caf container elliot type number true colorTitleLink C9EC6 rolloverLinkColor E5792 rolloverLinkUnderline true met layoutTypes caf container stitch type number columns true colorTitleLink rolloverLinkColor E5792 rolloverLinkUnderline true titleBold true afs comdp-sedobullet lime gif met layoutTypes caf container toothless type true C9EC6 dto und url dto php? dto tscQs ContainerNotFoundException this container this message ContainerNotFoundException raised this container insert dust render try null throw new ContainerNotFoundException catch dto append try null throw new ContainerNotFoundException parentNode div void und dust render appendChild catch dto lazyload type asyn item length- insertAfter undefined typeof und onclick param dto signedLink onclick value dto gFeedSES default onclick value dto gFeedSES alternate onclick param dto visitorViewId onclick value dto postActionParameter feedback undefined typeof dto postActionParameter token und dto postActionParameter token undefined typeof dto postActionParameter token und csb dto postActionParameter token undefined typeof dto postActionParameter token und csn dto postActionParameter token dto postActionParameter token logErrorCode dto postActionParameter token logErrorCode dto postActionParameter token artificialBid dto postActionParameter token artificialBid dto pus tlt dto contentType prs dto rlStrategy dsb dto alternatePubId pdto caf transparent dto jsParameter und alternatePubId dto jsParameter alternate pubid requestParams dto jsParameter request each requestParams pdto caf requestParams adult und true adult und adult! !0ds! und adult u SecondTierDat rls dto advt und dto contentType und 3! dto contentType und appendCafRls complete renderContentBlock appendCafRls contentSecondTierDat rls lengthe und contentSecondTierDat rls length- contentSecondTierDat rls term this caf terms join this caf optimizeTerms push this caf createCaf apply this loadWebArchive url dto waUrl method GET dataType json success webArchiveDat webArchive dat complete renderWebArchive renderDomainName insert domainName dto domainName container-domainName renderBuyBox insert buybox vertical buyboxDat container-buybox vertical insert buybox salesbadge buyboxDat container-salesbadge renderSearchBox dto advt?insert 1tier insert 2tier searchBoxDat container-searchbox renderContentBlock dto advt?insert content 1tier dto container-content insert content 2tier contentSecondTierDat container-content renderBuyBox dto contentType und 3! dto contentTypeloadWebArchive renderWebArchive insert webarchive stati webArchiveDat container-webarchive renderDisclaimer insert disclaimer disclaimerDat container-disclaimer renderImprint insert imprint imprintUrl dto imprintUrl container-imprint renderPrivacyPolicy dto contentType und insert privacy policy privacyPolicyDat container-privacyPolicy polyglot new polyglot extend dto i18n template helper translate polyglot und window location href und rendered html get logjserr php ms file line window onerror buyboxDat toSell dto toSell toSellUrl dto toSellUrl toSellText dto toSellText noFollow dto noFollow buybox dto buybox buyboxTopi dto buyboxTopi dnsh dto dnsh dpsh dto dpsh BUYBOX TOPI template helper translate BUYBOX TOPI BUYBOX TEASER PRICE template helper translate BUYBOX TEASER PRICE domainName dto domainName domainPrice dto domainPrice domainCurrency dto domainCurrency BUYBOX TEASER NOPRICE template helper translate BUYBOX TEASER NOPRICE domainName dto domainName BUYBOX BROKERAGE template helper translate BUYBOX BROKERAGE BUYBOX INQUIRE template helper translate BUYBOX INQUIRE TOSELL TEASER template helper translate TOSELL TEASER searchBoxDat dto searchParams dto gts TOPI template helper translate TOPI template helper translate disclaimerDat logoUrl sedoparkin comtemplatesbrick gfxcommonlogo white lan dto lan FOOTER TEASER template helper translate FOOTER TEASER sedoParkingUrl dto sedoParkingUrl FOOTER DISCLAIMER template helper translate FOOTER DISCLAIMER privacyPolicyDat PRIVACY POLICY TXT template helper translate PRIVACY POLICY TXT PRIVACY POLICY template helper translate PRIVACY POLICY contentSecondTierDat contentType dto contentType ads dto rlSes rls SPONSORED LINKS template helper translate SPONSORED LINKS RELATEDLINKS TOPI template helper translate RELATEDLINKS TOPI webArchiveDat contentId webarchive dto pus webArchive POPULAR CATEGORIES template helper translate POPULAR CATEGORIES dto domainName und renderDomainName dto und renderSearchBox dto rlUrl und dto rlStrategy?loadRls renderContentBlock dto disclaimer und renderDisclaimer dto imprint und renderImprint renderPrivacyPolicy dto maid und iam dat st sedo cp 322 iom iam da -relatedlinks active container-relatedlinks focus color E5792 container-relatedlinks color C1C1C container-relatedlinks link container-relatedlinks visited color container-relatedlinks hover container-relatedlinks active container-relatedlinks focus color E5792 content-ads color content-ads link content-ads visited color content-ads hover content-ads active content-ads focus color E5792 content-ads color C1C1C content-ads link content-ads visited color content-ads hover content-ads active content-ads focus color E5792 input button none repeat transparent color C9EC6 B2B2B2 content-webarchive color content-webarchive div webarchive-block link content-webarchive div webarchive-block visited color content-webarchive div webarchive-block active content-webarchive div webarchive-block focus content-webarchive div webarchive-block hover color E5792 text-decoration none content-webarchive div webarchive-block link content-webarchive div webarchive-block visited color content-webarchive div webarchive-block hover content-webarchive div webarchive-block active content-webarchive div webarchive-block focus color E5792 body font-size font-family Arial Helvetic Verdan Lucid Grande sans-serif container-header container-content container-ads overflow hidden container-content margin-bottom solid container-footer paddin container-footer font-size container-ads -280px -342px padding-top float left nessie oneclick content-relatedlinks margin paddin solid margin paddin -webkit-box-shadow box-shadow float left position relative twoclick container-relatedlinks -280px padding-top padding-bottom float left twoclick content-relatedlinks margin paddin solid auto !important paddin webarchive container-webarchive -280px padding-top padding-bottom float left webarchive content-webarchive auto !important paddin container-domainName domain font-size font-weight bold text-decoration none text-transform lowercase word-wrap break-word oneclick content-relatedlinks paddin font-size oneclick content-relatedlinks link oneclick content-relatedlinks visited text-decoration none oneclick content-relatedlinks hover oneclick content-relatedlinks active oneclick content-relatedlinks focus text-decoration underline twoclick content-relatedlinks zoom twoclick content-relatedlinks before twoclick content-relatedlinks after content display table twoclick content-relatedlinks after clear both twoclick content-relatedlinks padding-bottom twoclick content-relatedlinks span twoclick content-relatedlinks left float left twoclick content-relatedlinks right float right twoclick content-relatedlinks paddin twoclick content-relatedlinks font-weight bold font-size twoclick content-relatedlinks before content url sedoparkin comtemplatesbrick gfx1006bullet lime gif float left paddin content-ads before content url sedoparkin comtemplatesbrick gfx1006bullet lime gif float left paddin content-ads div padding-left content-ads div font-size text-transform uppercase font-weight bold content-ads div font-size content-ads div font-size dto domainName ljt domain ners for DEBU for slice length return!0 Stream prototype this typeof b?dust lo No callback provided for event WARN push this Stream prototype pipe typeof write typeof end dust lo Incompatible stream passed pipe WARN this typeof emit und emit pipe this typeof on und on error this dat try write utf8 catch dust lo ERROR end try end catch dust lo ERROR Chunk prototype write this taps und this dat push this Chunk prototype end und this write this flushable this root flush this Chunk prototype map new Chunk this root this next this taps new Chunk this root this taps this next this flushable try catch dust lo ERROR setError Chunk prototype tap this taps b?b push new Tap this Chunk prototype untap this taps tail this Chunk prototype render this Chunk prototype reference typeof a? apply current this null auto filters instanceof Chunk? this reference dust isThenable ?this await null dust isStreamable ?this stream null dust isEmpty ?this write dust filter Chunk prototype section block else this typeof und !dust isTemplateFn try apply current this catch dust lo k ERROR this setError instanceof Chunk dust isEmptyObject push dust isArray length for stack und stack head len idx push idx void len void i i this else dust isThenable this await dust isStreamable this stream this else a0 this push else i i this dust lo Section without correspondin key template getTemplateName DEBU this Chunk prototype exists block else dust isEmpty this else this dust lo No block for exists template getTemplateName DEBU this Chunk prototype notexists block else dust isEmpty this dust lo No block for not-exists template getTemplateName DEBU else this Chunk prototype block d?d this Chunk prototype partial void und dust isEmptyObject clone pop push dust isTemplateFn ?this capture templateName load end templateName load this Chunk prototype helper this filters void und !dust helpers dust lo Helper does not exist WARN try dust helpers instanceof Chunk?f strin typeof und split dust isEmptyObject ? reference section catch dust lo Error helper i message ERROR setError Chunk prototype await this map then c?f section reference end und error d?f render push end dust lo Unhandled promise rejection getTemplateName INFO end Chunk prototype stream und block und error this map on dat i f?h map render push end reference error i g?h render push dust lo Unhandled stream error getTemplateName INFO i end Chunk prototype capture this map new Stub a?d setError head end Chunk prototype setError this error this root flush this for Chunk prototype dust aliases und Chunk prototype dust aliases Chunk prototype Tap prototype push new Tap this Tap prototype for this head tail HCHARS und AMP und QUOT SQUOT dust escapeHtml strin typeof und typeof toString? strin typeof und toStrin HCHARS test ? replace AMP und replace QUOT replace SQUOT und BS FS LS u2028 PS u2029 NL LF SQ DQ TB dust strin typeof a? replace r replace u2028 replace u2029 replace n replace dust JSON?JSON stringify replace u2028 replace u2029 replace u003 dust lo JSON undefined could not escape WARN ned typeof console und console log? console lo typeof a?function apply console arguments Array prototype slice apply arguments join EMPTY FUN dust lo dINFO dust und dust NONE undefined typeof process und process env und bdust test process env DEBU und dust DEBU dust helpers dust cache dust register und templateName dust confi cache! und dust cache dust render new Stub head try load end catch setError dust stream new Stream head dust nextTick try load end catch setError dust loadSource source eval source dust isArray Array isArray?Array isArray object Array Object prototype toStrin call dust nextTick setTimeout dust isEmpty a?! dust isArray und length?!0 dust isEmptyObject null return! void return! length return! for Object prototype hasOwnProperty call return! return!0 dust isTemplateFn typeof und dustBody dust isThenable und object typeof und typeof then dust isStreamable und typeof on und typeof pipe dust filter for length und dust filters g?b null typeof h? dust lo Invalid filter WARN und dust filters dust escapeHtml dust u encodeURI encodeURIComponent dust jp JSON?JSON parse dust lo JSON undefined could not parse WARN dust makeBase dust context new Context void Context wrap instanceof Context? new Context null Context prototype get strin typeof und substr split this get Context prototype get this stack length und head und head?h head void else for und isObject head void tail void c? this global und this global for und i dust isThenable then getWithResolvedDat this slice i typeof h? try apply arguments catch throw dust lo ERROR dustBody !!h dustBody void und dust lo Cannot find reference join template this getTemplateName INFO Context prototype getPath this get Context prototype push void a? dust lo Not pushin undefined variable onto the context INFO this rebase new Stack this stack Context prototype pop this current this stack und this stack tail Context prototype rebase new Context this global this options this blocks this getTemplateName Context prototype clone this rebase stack this stack Context prototype current this stack und this stack head Context prototype getBlock typeof und new Chunk this dat join this blocks dust lo No blocks for context template this getTemplateName DEBU for length c-- dust lo Malformed template this getTemplateName was missin one more blocks Context prototype shiftBlocks this blocks a? c? concat new Context this stack this global this options this getTemplateName this Context prototype resolve typeof a? new Chunk render this instanceof Chunk?b dat join Context prototype getTemplateName this templateName Stub prototype flush for this head flushable error? this callback error dust lo Renderin failed with ERROR void this flush EMPTY FUN void this out dat join next this head this callback null this out Stream prototype flush for this head flushable error? this emit ERROR this emit end dust lo Streamin failed with ERROR void this flush EMPTY FUN void this emit dat join next this head this emit end Stream prototype emit this length dust lo Stream broadcastin but liste ljt - und nbspDiese Website steht zum Verkauf! und nbspInformationen zum Them text-center text-align center left container-left float left right container-right float right container-buybox empty container-domainName empty container-content empty container-disclaimer empty container-webarchive empty container-imprint empty container-privacyPolicy empty left empty right empty container-relatedlinks empty content-relatedlinks empty container-ads empty display none font-size margin normalize css MIT License git ionormalize article aside details figcaption figure footer header hgroup main nav section summary display block audio canvas video display inline-block display inline zoom audio not controls display none hidden display none html font-size -ms-text-size-adjust -webkit-text-size-adjust html button input select textare font-family sans-serif body focus outline thin dotted active hover outline font-size abbr title dotted stron font-weight bold blockquote dfn itali -moz-box-sizin content-box -webkit-box-sizin content-box box-sizin content-box mark FFFF00 color pre code kbd pre samp font-family monospace serif font-family courier new monospace font-size pre white-space pre-wrap word-wrap break-word quotes none before after content none small font-size sub sup font-size position relative vertical-align baseline sup top sub bottom menu none nav none -ms-interpolation-mode bicubi not root overflow hidden figure form fieldset none paddin legend white-space normal margin-left -7px button input select textare font-size vertical-align middle button input normal button select text-transform none button html input type button input type reset input type submit -webkit-appearance button cursor overflow visible button disabled html input disabled cursor default input type radio -webkit-box-sizin -moz-box-sizin box-sizin input type -webkit-appearance textfield -moz-box-sizin content-box -webkit-box-sizin content-box box-sizin content-box input type -webkit-appearance none button -moz-focus-inner input -moz-focus-inner textare overflow auto vertical-align top table collapse fieldset margin right vertical margin menu dir -moz-padding-start dose12 position absolute top -500px content-disclaimer font-size content-disclaimer sedologo float left content-disclaimer link content-disclaimer visited text-decoration underline content-disclaimer active content-disclaimer focus content-disclaimer hover text-decoration none privacy-policy-text display none solid paddin margin-top privacy-policy-link clear both float right label display none input button solid paddin input margin-right button font-weight bold cursor padding-left padding-right content-imprint clear both content-imprint link content-imprint visited display block text-align center paddin text-decoration underline content-imprint hover content-imprint active content-imprint focus text-decoration none content-webarchive zoom paddin content-webarchive before content-webarchive after content display table content-webarchive after clear both content-webarchive font- nd adult! !1ds! push und adult und client faillisted und push csb needsreview und needsreview error code und -1! inArray parseInt error code und push csn undefined typeof und push error code undefined typeof und push und parseInt error code undefined typeof und length und url join undefined typeof alternatePubId und error code und -1! inArray parseInt error code pubId alternatePubId onclick param onclick value length und createCaf apply this und resultsPageBaseUrl caf? pus und las sedoparkin php? param each cafEl -1! inArray tlt this met layoutTypes ads this caf type und this caf number this caf type und prs this caf type und dsb push this caf pdto caf noAds delete pdto caf noAds resultsPageBaseUrl caf? pus onclick param onclick value onclick param onclick value pageLoadedCallback undefined typeof window createCaf ads domains Caf apply this prototype ads domains Caf prototype new arguments length und createCaf apply this typeof define und define amd?define object typeof exports?module exports Polyglot this use strict this phrases this extend phrases this currentLocale locale this allowMissin this warn warni for hasOwnProperty for replace null! und a? split for und hasOwnProperty und replace new console und console warn und console WARNIN for VERSION prototype locale und this currentLocale prototype extend for hasOwnProperty und object typeof c?this extend this phrases prototype clear this phrases prototype replace this clear this extend prototype null b? number typeof und smart count strin typeof this phrases ? this phrases strin typeof ? this allowMissing? this warn Missin translation for key strin typeof und this currentLocale smart count prototype has in this phrases chinese german a? french 1? russian 10 und 100! 11?0 10 und ? czech a?0 und a? polish a?0 10 und ? icelandi 10! 11? chinese ko ms tr german es el hu nl pt french tl pt-br russian ru czech polish icelandi is typeof define und define amd und define amd dust !0?define dust core object typeof exports?module exports dust this getTemplate a? typeof und template? template dust isTemplateFn ? b! !1?dust cache void load setError new Error template name provided render getTemplate dust confi cache d?d Context wrap templateName dust onLoad?b map if setError getTemplate dust confi cache !dust compile setError new Error Dust compiler not available dust loadSource dust compile Context wrap templateName end 3 dust onLoad length?dust onLoad options dust onLoad setError new Error Template Not Found Context void instanceof Stack new Stack this global this options this blocks this templateName getWithResolvedDat push get Stack this tail this isObject und object typeof this head this index this Stub this head new Chunk this callback this out Stream this head new Chunk this root this next this dat this flushable this taps Tap this head this tail dust version 7 NONE ERROR WARN INFO DEBU EMPTY FUN dust confi whitespace amd cjs cache dust aliases write end map render reference section exists notexists block partial helper DEBU INFO WARN ERROR NONE undefi | Diese | Sex xXx fick Erotik sexy hardcore
1. PR-Navi.de ljt.de
2. PR-Navi.de ljt.de



Sparen
| ljf de domain ljf de domain idn ljf de price value currency EUR price minimum null states canUnbounce true SmartDomainSale Möchten Sie Ihre Domains auch einfach und elegant präsentieren? Anmelden Konto erstellen Po resse Telefonnummer Name Angebot EUR Unterbreiten Sie ein faires Angebot dann erhöht sich Ihre Chance auf eine schnelle Reaktion Bitte bestätigen Lade Bild Abschicken Kontakt aufnehmen Abschicken Bitte warten Sie! könnten Sie diese Domains interessieren Nein Danke Entdecken Sie weitere Domains! Diese Seite ist mit SmartDomainSale gehostet Mehr entdecken Impressum Wir akzeptieren PayPal Zahlung ist SSL gesichert Diese Seite n utzt Cookies statistische Daten erfassen und das Surfvergnügen optimieren Mehr erfahrenEUR Ausblenden sds queue parentNode insertBefore async true src static smartdomainsale comembeddomain-tablev2 SmartDomainSale D n Eine passende Domain zeugt von höherer Relevanz gegenüber Suchenden und auch Suchmaschinen Man erreicht einfacher eine höhere Platzierungen und wird häufiger angeklickt Nicht zögern direkt kontaktieren! E-Mail-Ad inen besseren Eindruck Unkomplizierte Abwicklung Der Handel mit Domains ist sehr einfach Nach Zahlungseingang erhalten Sie einen Authcode zur Übertragung und Sie können sofort loslegen Hohe Klickrate Suchergebnisse omainTable window tableCtrl push init window SDS base host admin smartdomainsale com api null tracking smartdomainsale com window SDS domain ljf de domain idn ljf de price value currency EUR price minimum null Langfristiger Nutzen durch einmalige Investition Die richtige Domain spart auf Dauer viel Geld Jede Domain ist einzigartig und dadurch ein Vermögenswert mit stetiger Wertsteigerung Lange Nutzungsdauer Gegensatz an wered SmartDomainSale ljf de Diese Premiumdomain kann für EUR erworben werden Das Angebot gilt nur für kurze Dauer! Direkt für EUR kaufen oder Kontakt aufnehmen Alle Preise beinhalten die gesetzliche Mehrwertsteuer deren Marketingaktivitäten kann man durch eine einzige gekaufte Domain beliebig lange profitieren Professioneller Eindruck Sie erreichen viel besser Ihre Zielgruppe mit der richtigen Domain und hinterlassen sogar e | ljf.de |
Sex xXx fick Erotik sexy hardcore | 1. PR-Navi.de ljf.de
2. ljf.de PR-Navi.de



---
1 2

Domde_00 Domde_0a Domde_0b Domde_0c Domde_0d Domde_0e Domde_0f Domde_0g Domde_0h Domde_0i Domde_0j Domde_0k Domde_0l Domde_0m Domde_0n Domde_0o Domde_0p Domde_0q Domde_0r Domde_0s Domde_0t Domde_0u Domde_0v Domde_0w Domde_0x Domde_0y Domde_0z Domde_a0 Domde_aa Domde_ab Domde_ac Domde_ad Domde_ae Domde_af Domde_ag Domde_ah Domde_ai Domde_aj Domde_ak Domde_al Domde_am Domde_an Domde_ao Domde_ap Domde_aq Domde_ar Domde_as Domde_at Domde_au Domde_av Domde_aw Domde_ax Domde_ay Domde_az Domde_b0 Domde_ba Domde_bb Domde_bc Domde_bd Domde_be Domde_bf Domde_bg Domde_bh Domde_bi Domde_bj Domde_bk Domde_bl Domde_bm Domde_bn Domde_bo Domde_bp Domde_bq Domde_br Domde_bs Domde_bt Domde_bu Domde_bv Domde_bw Domde_bx Domde_by Domde_bz Domde_c0 Domde_ca Domde_cb Domde_cc Domde_cd Domde_ce Domde_cf Domde_cg Domde_ch Domde_ci Domde_cj Domde_ck Domde_cl Domde_cm Domde_cn Domde_co Domde_cp Domde_cq Domde_cr Domde_cs Domde_ct Domde_cu Domde_cv Domde_cw Domde_cx Domde_cy Domde_cz Domde_d0 Domde_da Domde_db Domde_dc Domde_dd Domde_de Domde_df Domde_dg Domde_dh Domde_di Domde_dj Domde_dk Domde_dl Domde_dm Domde_dn Domde_do Domde_dp Domde_dq Domde_dr Domde_ds Domde_dt Domde_du Domde_dv Domde_dw Domde_dx Domde_dy Domde_dz Domde_e0 Domde_ea Domde_eb Domde_ec Domde_ed Domde_ee Domde_ef Domde_eg Domde_eh Domde_ei Domde_ej Domde_ek Domde_el Domde_em Domde_en Domde_eo Domde_ep Domde_eq Domde_er Domde_es Domde_et Domde_eu Domde_ev Domde_ew Domde_ex Domde_ey Domde_ez Domde_f0 Domde_fa Domde_fb Domde_fc Domde_fd Domde_fe Domde_ff Domde_fg Domde_fh Domde_fi Domde_fj Domde_fk Domde_fl Domde_fm Domde_fn Domde_fo Domde_fp Domde_fq Domde_fr Domde_fs Domde_ft Domde_fu Domde_fv Domde_fw Domde_fx Domde_fy Domde_fz Domde_g0 Domde_ga Domde_gb Domde_gc Domde_gd Domde_ge Domde_gf Domde_gg Domde_gh Domde_gi Domde_gj Domde_gk Domde_gl Domde_gm Domde_gn Domde_go Domde_gp Domde_gq Domde_gr Domde_gs Domde_gt Domde_gu Domde_gv Domde_gw Domde_gx Domde_gy Domde_gz Domde_h0 Domde_ha Domde_hb Domde_hc Domde_hd Domde_he Domde_hf Domde_hg Domde_hh Domde_hi Domde_hj Domde_hk Domde_hl Domde_hm Domde_hn Domde_ho Domde_hp Domde_hq Domde_hr Domde_hs Domde_ht Domde_hu Domde_hv Domde_hw Domde_hx Domde_hy Domde_hz Domde_i0 Domde_ia Domde_ib Domde_ic Domde_id Domde_ie Domde_if Domde_ig Domde_ih Domde_ii Domde_ij Domde_ik Domde_il Domde_im Domde_in Domde_io Domde_ip Domde_iq Domde_ir Domde_is Domde_it Domde_iu Domde_iv Domde_iw Domde_ix Domde_iy Domde_iz Domde_j0 Domde_ja Domde_jb Domde_jc Domde_jd Domde_je Domde_jf Domde_jg Domde_jh Domde_ji Domde_jj Domde_jk Domde_jl Domde_jm Domde_jn Domde_jo Domde_jp Domde_jq Domde_jr Domde_js Domde_jt Domde_ju Domde_jv Domde_jw Domde_jx Domde_jy Domde_jz Domde_k0 Domde_ka Domde_kb Domde_kc Domde_kd Domde_ke Domde_kf Domde_kg Domde_kh Domde_ki Domde_kj Domde_kk Domde_kl Domde_km Domde_kn Domde_ko Domde_kp Domde_kq Domde_kr Domde_ks Domde_kt Domde_ku Domde_kv Domde_kw Domde_kx Domde_ky Domde_kz Domde_l0 Domde_la Domde_lb Domde_lc Domde_ld Domde_le Domde_lf Domde_lg Domde_lh Domde_li Domde_lj Domde_lk Domde_ll Domde_lm Domde_ln Domde_lo Domde_lp Domde_lq Domde_lr Domde_ls Domde_lt Domde_lu Domde_lv Domde_lw Domde_lx Domde_ly Domde_lz Domde_m0 Domde_ma Domde_mb Domde_mc Domde_md Domde_me Domde_mf Domde_mg Domde_mh Domde_mi Domde_mj Domde_mk Domde_ml Domde_mm Domde_mn Domde_mo Domde_mp Domde_mq Domde_mr Domde_ms Domde_mt Domde_mu Domde_mv Domde_mw Domde_mx Domde_my Domde_mz Domde_n0 Domde_na Domde_nb Domde_nc Domde_nd Domde_ne Domde_nf Domde_ng Domde_nh Domde_ni Domde_nj Domde_nk Domde_nl Domde_nm Domde_nn Domde_no Domde_np Domde_nq Domde_nr Domde_ns Domde_nt Domde_nu Domde_nv Domde_nw Domde_nx Domde_ny Domde_nz Domde_o0 Domde_oa Domde_ob Domde_oc Domde_od Domde_oe Domde_of Domde_og Domde_oh Domde_oi Domde_oj Domde_ok Domde_ol Domde_om Domde_on Domde_oo Domde_op Domde_oq Domde_or Domde_os Domde_ot Domde_ou Domde_ov Domde_ow Domde_ox Domde_oy Domde_oz Domde_p0 Domde_pa Domde_pb Domde_pc Domde_pd Domde_pe Domde_pf Domde_pg Domde_ph Domde_pi Domde_pj Domde_pk Domde_pl Domde_pm Domde_pn Domde_po Domde_pp Domde_pq Domde_pr Domde_ps Domde_pt Domde_pu Domde_pv Domde_pw Domde_px Domde_py Domde_pz Domde_q0 Domde_qa Domde_qb Domde_qc Domde_qd Domde_qe Domde_qf Domde_qg Domde_qh Domde_qi Domde_qj Domde_qk Domde_ql Domde_qm Domde_qn Domde_qo Domde_qp Domde_qq Domde_qr Domde_qs Domde_qt Domde_qu Domde_qv Domde_qw Domde_qx Domde_qy Domde_qz Domde_r0 Domde_ra Domde_rb Domde_rc Domde_rd Domde_re Domde_rf Domde_rg Domde_rh Domde_ri Domde_rj Domde_rk Domde_rl Domde_rm Domde_rn Domde_ro Domde_rp Domde_rq Domde_rr Domde_rs Domde_rt Domde_ru Domde_rv Domde_rw Domde_rx Domde_ry Domde_rz Domde_s0 Domde_sa Domde_sb Domde_sc Domde_sd Domde_se Domde_sf Domde_sg Domde_sh Domde_si Domde_sj Domde_sk Domde_sl Domde_sm Domde_sn Domde_so Domde_sp Domde_sq Domde_sr Domde_ss Domde_st Domde_su Domde_sv Domde_sw Domde_sx Domde_sy Domde_sz Domde_t0 Domde_ta Domde_tb Domde_tc Domde_td Domde_te Domde_tf Domde_tg Domde_th Domde_ti Domde_tj Domde_tk Domde_tl Domde_tm Domde_tn Domde_to Domde_tp Domde_tq Domde_tr Domde_ts Domde_tt Domde_tu Domde_tv Domde_tw Domde_tx Domde_ty Domde_tz Domde_u0 Domde_ua Domde_ub Domde_uc Domde_ud Domde_ue Domde_uf Domde_ug Domde_uh Domde_ui Domde_uj Domde_uk Domde_ul Domde_um Domde_un Domde_uo Domde_up Domde_uq Domde_ur Domde_us Domde_ut Domde_uu Domde_uv Domde_uw Domde_ux Domde_uy Domde_uz Domde_v0 Domde_va Domde_vb Domde_vc Domde_vd Domde_ve Domde_vf Domde_vg Domde_vh Domde_vi Domde_vj Domde_vk Domde_vl Domde_vm Domde_vn Domde_vo Domde_vp Domde_vq Domde_vr Domde_vs Domde_vt Domde_vu Domde_vv Domde_vw Domde_vx Domde_vy Domde_vz Domde_w0 Domde_wa Domde_wb Domde_wc Domde_wd Domde_we Domde_wf Domde_wg Domde_wh Domde_wi Domde_wj Domde_wk Domde_wl Domde_wm Domde_wn Domde_wo Domde_wp Domde_wq Domde_wr Domde_ws Domde_wt Domde_wu Domde_wv Domde_ww Domde_wx Domde_wy Domde_wz Domde_x0 Domde_xa Domde_xb Domde_xc Domde_xd Domde_xe Domde_xf Domde_xg Domde_xh Domde_xi Domde_xj Domde_xk Domde_xl Domde_xm Domde_xn Domde_xo Domde_xp Domde_xq Domde_xr Domde_xs Domde_xt Domde_xu Domde_xv Domde_xw Domde_xx Domde_xy Domde_xz Domde_y0 Domde_ya Domde_yb Domde_yc Domde_yd Domde_ye Domde_yf Domde_yg Domde_yh Domde_yi Domde_yj Domde_yk Domde_yl Domde_ym Domde_yn Domde_yo Domde_yp Domde_yq Domde_yr Domde_ys Domde_yt Domde_yu Domde_yv Domde_yw Domde_yx Domde_yy Domde_yz Domde_z0 Domde_za Domde_zb Domde_zc Domde_zd Domde_ze Domde_zf Domde_zg Domde_zh Domde_zi Domde_zj Domde_zk Domde_zl Domde_zm Domde_zn Domde_zo Domde_zp Domde_zq Domde_zr Domde_zs Domde_zt Domde_zu Domde_zv Domde_zw Domde_zx Domde_zy Domde_zz Domother_00 Domother_0a Domother_0b Domother_0c Domother_0d Domother_0e Domother_0f Domother_0g Domother_0h Domother_0i Domother_0j Domother_0k Domother_0l Domother_0m Domother_0n Domother_0o Domother_0p Domother_0q Domother_0r Domother_0s Domother_0t Domother_0u Domother_0v Domother_0w Domother_0x Domother_0y Domother_0z Domother_a0 Domother_aa Domother_ab Domother_ac Domother_ad Domother_ae Domother_af Domother_ag Domother_ah Domother_ai Domother_aj Domother_ak Domother_al Domother_am Domother_an Domother_ao Domother_ap Domother_aq Domother_ar Domother_as Domother_at Domother_au Domother_av Domother_aw Domother_ax Domother_ay Domother_az Domother_b0 Domother_ba Domother_bb Domother_bc Domother_bd Domother_be Domother_bf Domother_bg Domother_bh Domother_bi Domother_bj Domother_bk Domother_bl Domother_bm Domother_bn Domother_bo Domother_bp Domother_bq Domother_br Domother_bs Domother_bt Domother_bu Domother_bv Domother_bw Domother_bx Domother_by Domother_bz Domother_c0 Domother_ca Domother_cb Domother_cc Domother_cd Domother_ce Domother_cf Domother_cg Domother_ch Domother_ci Domother_cj Domother_ck Domother_cl Domother_cm Domother_cn Domother_co Domother_cp Domother_cq Domother_cr Domother_cs Domother_ct Domother_cu Domother_cv Domother_cw Domother_cx Domother_cy Domother_cz Domother_d0 Domother_da Domother_db Domother_dc Domother_dd Domother_de Domother_df Domother_dg Domother_dh Domother_di Domother_dj Domother_dk Domother_dl Domother_dm Domother_dn Domother_do Domother_dp Domother_dq Domother_dr Domother_ds Domother_dt Domother_du Domother_dv Domother_dw Domother_dx Domother_dy Domother_dz Domother_e0 Domother_ea Domother_eb Domother_ec Domother_ed Domother_ee Domother_ef Domother_eg Domother_eh Domother_ei Domother_ej Domother_ek Domother_el Domother_em Domother_en Domother_eo Domother_ep Domother_eq Domother_er Domother_es Domother_et Domother_eu Domother_ev Domother_ew Domother_ex Domother_ey Domother_ez Domother_f0 Domother_fa Domother_fb Domother_fc Domother_fd Domother_fe Domother_ff Domother_fg Domother_fh Domother_fi Domother_fj Domother_fk Domother_fl Domother_fm Domother_fn Domother_fo Domother_fp Domother_fq Domother_fr Domother_fs Domother_ft Domother_fu Domother_fv Domother_fw Domother_fx Domother_fy Domother_fz Domother_g0 Domother_ga Domother_gb Domother_gc Domother_gd Domother_ge Domother_gf Domother_gg Domother_gh Domother_gi Domother_gj Domother_gk Domother_gl Domother_gm Domother_gn Domother_go Domother_gp Domother_gq Domother_gr Domother_gs Domother_gt Domother_gu Domother_gv Domother_gw Domother_gx Domother_gy Domother_gz Domother_h0 Domother_ha Domother_hb Domother_hc Domother_hd Domother_he Domother_hf Domother_hg Domother_hh Domother_hi Domother_hj Domother_hk Domother_hl Domother_hm Domother_hn Domother_ho Domother_hp Domother_hq Domother_hr Domother_hs Domother_ht Domother_hu Domother_hv Domother_hw Domother_hx Domother_hy Domother_hz Domother_i0 Domother_ia Domother_ib Domother_ic Domother_id Domother_ie Domother_if Domother_ig Domother_ih Domother_ii Domother_ij Domother_ik Domother_il Domother_im Domother_in Domother_io Domother_ip Domother_iq Domother_ir Domother_is Domother_it Domother_iu Domother_iv Domother_iw Domother_ix Domother_iy Domother_iz Domother_j0 Domother_ja Domother_jb Domother_jc Domother_jd Domother_je Domother_jf Domother_jg Domother_jh Domother_ji Domother_jj Domother_jk Domother_jl Domother_jm Domother_jn Domother_jo Domother_jp Domother_jq Domother_jr Domother_js Domother_jt Domother_ju Domother_jv Domother_jw Domother_jx Domother_jy Domother_jz Domother_k0 Domother_ka Domother_kb Domother_kc Domother_kd Domother_ke Domother_kf Domother_kg Domother_kh Domother_ki Domother_kj Domother_kk Domother_kl Domother_km Domother_kn Domother_ko Domother_kp Domother_kq Domother_kr Domother_ks Domother_kt Domother_ku Domother_kv Domother_kw Domother_kx Domother_ky Domother_kz Domother_l0 Domother_la Domother_lb Domother_lc Domother_ld Domother_le Domother_lf Domother_lg Domother_lh Domother_li Domother_lj Domother_lk Domother_ll Domother_lm Domother_ln Domother_lo Domother_lp Domother_lq Domother_lr Domother_ls Domother_lt Domother_lu Domother_lv Domother_lw Domother_lx Domother_ly Domother_lz Domother_m0 Domother_ma Domother_mb Domother_mc Domother_md Domother_me Domother_mf Domother_mg Domother_mh Domother_mi Domother_mj Domother_mk Domother_ml Domother_mm Domother_mn Domother_mo Domother_mp Domother_mq Domother_mr Domother_ms Domother_mt Domother_mu Domother_mv Domother_mw Domother_mx Domother_my Domother_mz Domother_n0 Domother_na Domother_nb Domother_nc Domother_nd Domother_ne Domother_nf Domother_ng Domother_nh Domother_ni Domother_nj Domother_nk Domother_nl Domother_nm Domother_nn Domother_no Domother_np Domother_nq Domother_nr Domother_ns Domother_nt Domother_nu Domother_nv Domother_nw Domother_nx Domother_ny Domother_nz Domother_o0 Domother_oa Domother_ob Domother_oc Domother_od Domother_oe Domother_of Domother_og Domother_oh Domother_oi Domother_oj Domother_ok Domother_ol Domother_om Domother_on Domother_oo Domother_op Domother_oq Domother_or Domother_os Domother_ot Domother_ou Domother_ov Domother_ow Domother_ox Domother_oy Domother_oz Domother_p0 Domother_pa Domother_pb Domother_pc Domother_pd Domother_pe Domother_pf Domother_pg Domother_ph Domother_pi Domother_pj Domother_pk Domother_pl Domother_pm Domother_pn Domother_po Domother_pp Domother_pq Domother_pr Domother_ps Domother_pt Domother_pu Domother_pv Domother_pw Domother_px Domother_py Domother_pz Domother_q0 Domother_qa Domother_qb Domother_qc Domother_qd Domother_qe Domother_qf Domother_qg Domother_qh Domother_qi Domother_qj Domother_qk Domother_ql Domother_qm Domother_qn Domother_qo Domother_qp Domother_qq Domother_qr Domother_qs Domother_qt Domother_qu Domother_qv Domother_qw Domother_qx Domother_qy Domother_qz Domother_r0 Domother_ra Domother_rb Domother_rc Domother_rd Domother_re Domother_rf Domother_rg Domother_rh Domother_ri Domother_rj Domother_rk Domother_rl Domother_rm Domother_rn Domother_ro Domother_rp Domother_rq Domother_rr Domother_rs Domother_rt Domother_ru Domother_rv Domother_rw Domother_rx Domother_ry Domother_rz Domother_s0 Domother_sa Domother_sb Domother_sc Domother_sd Domother_se Domother_sf Domother_sg Domother_sh Domother_si Domother_sj Domother_sk Domother_sl Domother_sm Domother_sn Domother_so Domother_sp Domother_sq Domother_sr Domother_ss Domother_st Domother_su Domother_sv Domother_sw Domother_sx Domother_sy Domother_sz Domother_t0 Domother_ta Domother_tb Domother_tc Domother_td Domother_te Domother_tf Domother_tg Domother_th Domother_ti Domother_tj Domother_tk Domother_tl Domother_tm Domother_tn Domother_to Domother_tp Domother_tq Domother_tr Domother_ts Domother_tt Domother_tu Domother_tv Domother_tw Domother_tx Domother_ty Domother_tz Domother_u0 Domother_ua Domother_ub Domother_uc Domother_ud Domother_ue Domother_uf Domother_ug Domother_uh Domother_ui Domother_uj Domother_uk Domother_ul Domother_um Domother_un Domother_uo Domother_up Domother_uq Domother_ur Domother_us Domother_ut Domother_uu Domother_uv Domother_uw Domother_ux Domother_uy Domother_uz Domother_v0 Domother_va Domother_vb Domother_vc Domother_vd Domother_ve Domother_vf Domother_vg Domother_vh Domother_vi Domother_vj Domother_vk Domother_vl Domother_vm Domother_vn Domother_vo Domother_vp Domother_vq Domother_vr Domother_vs Domother_vt Domother_vu Domother_vv Domother_vw Domother_vx Domother_vy Domother_vz Domother_w0 Domother_wa Domother_wb Domother_wc Domother_wd Domother_we Domother_wf Domother_wg Domother_wh Domother_wi Domother_wj Domother_wk Domother_wl Domother_wm Domother_wn Domother_wo Domother_wp Domother_wq Domother_wr Domother_ws Domother_wt Domother_wu Domother_wv Domother_ww Domother_wx Domother_wy Domother_wz Domother_x0 Domother_xa Domother_xb Domother_xc Domother_xd Domother_xe Domother_xf Domother_xg Domother_xh Domother_xi Domother_xj Domother_xk Domother_xl Domother_xm Domother_xn Domother_xo Domother_xp Domother_xq Domother_xr Domother_xs Domother_xt Domother_xu Domother_xv Domother_xw Domother_xx Domother_xy Domother_xz Domother_y0 Domother_ya Domother_yb Domother_yc Domother_yd Domother_ye Domother_yf Domother_yg Domother_yh Domother_yi Domother_yj Domother_yk Domother_yl Domother_ym Domother_yn Domother_yo Domother_yp Domother_yq Domother_yr Domother_ys Domother_yt Domother_yu Domother_yv Domother_yw Domother_yx Domother_yy Domother_yz Domother_z0 Domother_za Domother_zb Domother_zc Domother_zd Domother_ze Domother_zf Domother_zg Domother_zh Domother_zi Domother_zj Domother_zk Domother_zl Domother_zm Domother_zn Domother_zo Domother_zp Domother_zq Domother_zr Domother_zs Domother_zt Domother_zu Domother_zv Domother_zw Domother_zx Domother_zy Domother_zz



Security- Schutz- Alarm- Sicherheitstechnik Kategorien: 132 Einträge: 0 Sponsored by » Abhörschutz & Abhörsicherheit » Akkreditierungs- & Ausweismanagement » Akten & Dokumente... Shoppen, Online-Shops & Schnäppchenportale Kategorien: 21 Einträge: 0 Sponsored by » 1.- Euro Shops » All in One Shops » Auktionen & Auktionshäuser... Sparen Kategorien: 1 Einträge: 0 Sponsored by » Sparen » Blog, Foren & Chats » Clubs, Vereine & Gruppen... Spass, Humor & Witze Kategorien: 17 Einträge: 2 Sponsored by » Bildbewertung » Comics & Cartoons » Computer... Spenden, Hilfe & Entwicklung Kategorien: 1 Einträge: 0 Sponsored by » Spenden, Hilfe & Entwicklung » Blog, Foren & Chats » Clubs, Vereine & Gruppen... Spielwaren, Games, Konsolen, Spielzeug Kategorien: 240 Einträge: 0 Sponsored by » Nach Altersempfehlung » ab 1 Jahr » ab 12 Jahren... Sport, Fitness & Spaß Kategorien: 680 Einträge: 0 Sponsored by » Ballsport » American Football » Aquaball... Sprachen, Übersetzungen & Dolmetscher Kategorien: 92 Einträge: 0 Sponsored by » Nach Sprache » Afrikaans » Albanisch... Transporte, Speditionen & Logistik Kategorien: 88 Einträge: 0 Sponsored by » Abschleppdienste » Bahn & Schienenverkehr » Import & Export... Transporte, Umzug & Beförderung Kategorien: 226 Einträge: 0 Sponsored by » 24 & 36h-Service » Overnight-Express » Anmelden & Ummelden... Versicherungen Kategorien: 112 Einträge: 0 Sponsored by » Agenturen & Vermittler » Direkt Versicherungen » Onlineabschluss... Wellness, Spa, Erholung & Entspannung Kategorien: 323 Einträge: 0 Sponsored by » Nach Zielgruppe » Damen, Frauen » Familien... Welt der Frau Kategorien: 1 Einträge: 1 Sponsored by » Welt der Frau » Blog, Foren & Chats » Clubs, Vereine & Gruppen... Welt der Männer Kategorien: 1 Einträge: 1 Sponsored by » Welt der Männer » Blog, Foren & Chats » Clubs, Vereine & Gruppen... Werbung, PR, Marketing & Promotion Kategorien: 160 Einträge: 0 Sponsored by » Nach Zielgruppe » Damen, Frauen » Familien... Weitere Seiten & Sonstiges Kategorien: 19 Einträge: 0 Sponsored by » An- & Verkauf » Filteranlagen & Filter » Fragen & Antworten... Keine Einträge vorhanden Einträge vorhanden Neue Einträge vorhanden Werbepartner Newsletter abonnieren Mehr Infos zu unserem Newsletter Neue Software per eMail? eMail-Adresse eintragen... Social Bookmarks Erotik & FSK18
www.PR-Navi.de

Baby, Familie, Kinder & Erziehung Kategorien: 160 Einträge: 0 Sponsored by » Baby & Kleinkinder » Ahnenforschung » Auto-Kindersitze... Bildung: Schulen, Unterricht, Uni Kategorien: 182 Einträge: 0 Sponsored by » Abschlussjahrgänge » Elternarbeit » Hochbegabung... Bildung: Wissenschaft, Wissen Kategorien: 414 Einträge: 0 Sponsored by » Anomalien & Alternative Wissenschaften » Atlantis » Bücher & Literatur... Bücher, eBooks, Literatur & Magazine Kategorien: 132 Einträge: 0 Sponsored by » Abkürzungen » Adressen & Telefonnummern » Anwählte, Notare, Recht & Gesetz... Büro, Betrieb & Gewerbe Kategorien: 353 Einträge: 0 Sponsored by » Akten & Dokumente » Akten- & Dokumentenmanagement » Datenträgermanagement... Computer, PC & Software Kategorien: 293 Einträge: 0 Sponsored by » Beratung, Service, Hilfe & Info » Computerbücher » EDV- Seminar... Druck, Printmedia & Druckerei Kategorien: 215 Einträge: 0 Sponsored by » Nach Anlass » Adventskalender » Anti-Valentinstag... Energieversorgung, Technik & Ressourcen Kategorien: 102 Einträge: 0 Sponsored by » Energie sparen & Energieberatung » Energieanbieter & Versorgung » Alternative Energien... Erotik, Sex & Co (FSK18) Kategorien: 1614 Einträge: 1614 Sponsored by » Agenturen » Begleitservice, Hostessen & Escort » Agenturen in der Schweiz... Esoterik, Astrologie & Horoskope Kategorien: 68 Einträge: 0 Sponsored by » Alchemie » alternatives Heilen » Amulette... Essen, Trinken: Ausgehen & Gastronomie Kategorien: 137 Einträge: 0 Sponsored by » Locations & Lounges » Ausflugs- & Wanderlokale » Autobahnraststätten... Essen, Trinken: Küche, Lebensmittel & Getränke Kategorien: 531 Einträge: 0 Sponsored by » Catering & Partyservice » Diät, Ernährung & Abnehmen » Abnehmen Tipps... Event-, Party- & Veranstaltungsservice Kategorien: 285 Einträge: 0 Sponsored by » Nach Fest, Feier & Anlass
www.PR-Navi.de

Mein, Dein, Unser “The Fast And The Furious” Club. Wir sind ein ONLINE Club, der hier möglichst viele Leute mit individuell getunten Autos versammeln möchte. Die Club Mitgliedschaft kostet natürlich nichts und es entstehen auch keine weiteren Kosten. Die Anmeldung und Nutzung der Seite ist absolut kostenfrei. Es geht um das Fast & Furious Feeling! Wir hoffen auf coole Leute und auf viele Bilder von euren Strassengleitern. Im Moment sind wir ein reiner online Club. Wer weiß, wenn hier viele Autos mit machen, könnte man später ein XFast XFurious Treffen veranstalten. Im Motto “The Fast And The Furious” Vorraussetzungen: Wenn man den Film “The Fast And The Furious” nicht kennt, ist man hier glaube ich fehl am Platz. :)))) Eingeladen ist jeder der mindestens eine oder zwei coole Bauveränderungen an seinem Auto vorgenommen hat. Hot Girls & geile Bikes dürfen natürlich auch nicht fehlen und sind auf jeden fall mit eingeladen. P.S. Es wäre cool von euch wenn ihr nach dem kostenlosen anmelden, in eurem Profil, den Code Fwfq/9Upk eingibt. Somit steigert ihr den HOT Faktor des Clubs um 100 Punkte und gleichzeitig bekommt ihr auch 100 HOT Punkte. Tuning Car Style, jeder ist eingeladen. -The Fast And The Furious Live Feeling-
www.HotOrSchrott.de

Mitmachen kann jeder & kostenlos! Und garantiert mit keinen weiteren Kosten verbunden. Eine Community lebt von vielen Mitgliedern, die sich am Community-Leben beteiligen! Also sagt euren Bekannten und Freunden bescheid!
Nutzt das E-Mail-System, das Forum und viele andere euch zur Verfügung stehende Funktionen!

  - Keine Vermittlungsprovision, keine kostenpflichtige 0900-Nummer
- Interessenten nehmen direkt mit Dir Kontakt auf
- Umkreissuche dank neuen Funktionen
- Einfache Navigation, klare Struktur der Seiten
- Übersichtliche Administrationsoberfläche
- Einbindung von FSK- 18- Bildern

Die Anmeldung und Nutzung der Seite ist absolut kostenfrei.
Das Sex-Gut.de -Team wünscht euch viel Spaß!
www.Sex-Gut.de

Kfz: Automobile, Zubehör & Co. Kategorien: 161 Einträge: 161 Sponsored by » EU-Neuwagen » Gebrauchtwagen » Jahreswagen... Kfz: Markenhäuser, Händler, Autohäuser, Info & Service Kategorien: 88 Einträge: 0 Sponsored by » Hersteller (Automobile) » Hersteller (Bus) » Hersteller (LKW)... Kfz: Motorräder, Zubehör & Co. Kategorien: 80 Einträge: 34 Sponsored by » Motorrad (Gebraucht) » Motorrad (Neu) » Old- & Youngtimer... Kfz: Nutzfahrzeuge, LKWs, Trucks, Zubehör & Co. Kategorien: 236 Einträge: 0 Sponsored by » Ersatzteile & Zubehör » Händler, Info & Service » Leasing... Kfz: Verkehr & Verschiedenes Kategorien: 128 Einträge: 1 Sponsored by » Benzin sparen » Boote & Zubehör » Hausboote... Kleidung, Schuhe, Mode & Accessoires Kategorien: 1057 Einträge: 0 Sponsored by » Accessoires » Anhänger & Anstecker » Ansteckblüten... Kosmetik, Schönheit, Lifestyle & Beauty Kategorien: 868 Einträge: 0 Sponsored by » Biokosmetik » Naturprodukte » Pflege Nacht... Kostenloses, Gratis & Gutscheine Kategorien: 6 Einträge: 0 Sponsored by » CDs & DVDs » Free & Shareware » Geschenk- & Werbeartikel... Kunst, Antiquitäten & Kultur Kategorien: 331 Einträge: 0 Sponsored by » Nach Kunststil & Epoche » Abstrakt » Acryl... Landwirtschaft, Technik, Umwelt & Natur Kategorien: 158 Einträge: 0 Sponsored by » Agrochemie » Aquakultur » Astronomie... Medien, Nachrichten & Informationen Kategorien: 228 Einträge: 0 Sponsored by » Aktuelle Nachrichten, Journalismus & Presse » Amtsblätter » Auslands Zeitungen... Medizin, Gesundheit & Pflege Kategorien: 834 Einträge: 0 Sponsored by » Alternative Medizin, Naturheilmittel & Heilpraktiker » Acai Beeren - Power » Akupunktur & Akupressur... Menschen, Vereine, Communitys, Gruppen & Treffs Kategorien: 24
www.PR-Navi.de



Home
www.pr-navi.de
www.pr-navi.de


www.pr-navi.de Sidemap Katalog Eintrag
www.pr-navi.de Sidemap Katalog Eintrag Dom
www.pr-navi.de Sidemap Anzeigen Eintrag

www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag

www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Katalog Eintrag Dom

www.pr-navi.de sidemap1 www.pr-navi.de sidemap2 www.pr-navi.de sidemap3 www.pr-navi.de sidemap4 www.pr-navi.de sidemap5 www.pr-navi.de sidemap6 www.pr-navi.de sidemap7 www.pr-navi.de sidemap8 www.pr-navi.de sidemap9 www.pr-navi.de sidemap10 www.pr-navi.de sidemap11 www.pr-navi.de sidemap12 www.pr-navi.de sidemap13 www.pr-navi.de sidemap14 www.pr-navi.de sidemap15 www.pr-navi.de sidemap16 www.pr-navi.de sidemap17 www.pr-navi.de sidemap18 www.pr-navi.de sidemap19 www.pr-navi.de sidemap20 www.pr-navi.de sidemap21 www.pr-navi.de sidemap22 www.pr-navi.de sidemap23 www.pr-navi.de sidemap24 www.pr-navi.de sidemap25 www.pr-navi.de sidemap26 www.pr-navi.de sidemap27 www.pr-navi.de sidemap28 www.pr-navi.de sidemap29 www.pr-navi.de sidemap30 www.pr-navi.de sidemap31 www.pr-navi.de sidemap32 www.pr-navi.de sidemap33 www.pr-navi.de sidemap34 www.pr-navi.de sidemap35 www.pr-navi.de sidemap36 www.pr-navi.de sidemap37 www.pr-navi.de sidemap38 www.pr-navi.de sidemap39 www.pr-navi.de sidemap40 www.pr-navi.de sidemap41 www.pr-navi.de sidemap42 www.pr-navi.de sidemap43 www.pr-navi.de sidemap44 www.pr-navi.de sidemap45 www.pr-navi.de sidemap46 www.pr-navi.de sidemap47 www.pr-navi.de sidemap48 www.pr-navi.de sidemap49 www.pr-navi.de sidemap50 www.pr-navi.de sidemap51 www.pr-navi.de sidemap52 www.pr-navi.de sidemap53 www.pr-navi.de sidemap54 www.pr-navi.de sidemap55 www.pr-navi.de sidemap56 www.pr-navi.de sidemap57 www.pr-navi.de sidemap58 www.pr-navi.de sidemap59 www.pr-navi.de sidemap60 www.pr-navi.de sidemap61 www.pr-navi.de sidemap62 www.pr-navi.de sidemap63 www.pr-navi.de sidemap64 www.pr-navi.de sidemap65 www.pr-navi.de sidemap66 www.pr-navi.de sidemap67 www.pr-navi.de sidemap68 www.pr-navi.de sidemap69 www.pr-navi.de sidemap70 www.pr-navi.de sidemap71 www.pr-navi.de sidemap72 www.pr-navi.de sidemap73 www.pr-navi.de sidemap74 www.pr-navi.de sidemap75 www.pr-navi.de sidemap76 www.pr-navi.de sidemap77 www.pr-navi.de sidemap78 www.pr-navi.de sidemap79 www.pr-navi.de sidemap80 www.pr-navi.de sidemap81 www.pr-navi.de sidemap82 www.pr-navi.de sidemap83 www.pr-navi.de sidemap84 www.pr-navi.de sidemap85 www.pr-navi.de sidemap86 www.pr-navi.de sidemap87 www.pr-navi.de sidemap88 www.pr-navi.de sidemap89 www.pr-navi.de sidemap90 www.pr-navi.de sidemap91 www.pr-navi.de sidemap92 www.pr-navi.de sidemap93 www.pr-navi.de sidemap94 www.pr-navi.de sidemap95 www.pr-navi.de sidemap96 www.pr-navi.de sidemap97 www.pr-navi.de sidemap98 www.pr-navi.de sidemap99 www.pr-navi.de sidemap100 www.pr-navi.de sidemap101 www.pr-navi.de sidemap102 www.pr-navi.de sidemap103 www.pr-navi.de sidemap104 www.pr-navi.de sidemap105 www.pr-navi.de sidemap106 www.pr-navi.de sidemap107 www.pr-navi.de sidemap108 www.pr-navi.de sidemap109 www.pr-navi.de sidemap110 www.pr-navi.de sidemap111 www.pr-navi.de sidemap112 www.pr-navi.de sidemap113 www.pr-navi.de sidemap114 www.pr-navi.de sidemap115 www.pr-navi.de sidemap116 www.pr-navi.de sidemap117 www.pr-navi.de sidemap118 www.pr-navi.de sidemap119 www.pr-navi.de sidemap120 www.pr-navi.de sidemap121 www.pr-navi.de sidemap122 www.pr-navi.de sidemap123 www.pr-navi.de sidemap124 www.pr-navi.de sidemap125 www.pr-navi.de sidemap126 www.pr-navi.de sidemap127 www.pr-navi.de sidemap128 www.pr-navi.de sidemap129 www.pr-navi.de sidemap130 www.pr-navi.de sidemap131 www.pr-navi.de sidemap132 www.pr-navi.de sidemap133 www.pr-navi.de sidemap134 www.pr-navi.de sidemap135 www.pr-navi.de sidemap136 www.pr-navi.de sidemap137 www.pr-navi.de sidemap138 www.pr-navi.de sidemap139 www.pr-navi.de sidemap140 www.pr-navi.de sidemap141 www.pr-navi.de sidemap142 www.pr-navi.de sidemap143 www.pr-navi.de sidemap144 www.pr-navi.de sidemap145 www.pr-navi.de sidemap146 www.pr-navi.de sidemap147 www.pr-navi.de sidemap148 www.pr-navi.de sidemap149 www.pr-navi.de sidemap150 www.pr-navi.de sidemap151 www.pr-navi.de sidemap152 www.pr-navi.de sidemap153 www.pr-navi.de sidemap154 www.pr-navi.de sidemap155 www.pr-navi.de sidemap156 www.pr-navi.de sidemap157 www.pr-navi.de sidemap158 www.pr-navi.de sidemap159 www.pr-navi.de sidemap160 www.pr-navi.de sidemap161 www.pr-navi.de sidemap162 www.pr-navi.de sidemap163 www.pr-navi.de sidemap164 www.pr-navi.de sidemap165 www.pr-navi.de sidemap166 www.pr-navi.de sidemap167 www.pr-navi.de sidemap168 www.pr-navi.de sidemap169 www.pr-navi.de sidemap170 www.pr-navi.de sidemap171 www.pr-navi.de sidemap172 www.pr-navi.de sidemap173 www.pr-navi.de sidemap174 www.pr-navi.de sidemap175 www.pr-navi.de sidemap176 www.pr-navi.de sidemap177 www.pr-navi.de sidemap178 www.pr-navi.de sidemap179 www.pr-navi.de sidemap180 www.pr-navi.de sidemap181 www.pr-navi.de sidemap182



Seite generiert in 1.1583 Sekunden