kostenlos

Navi

Linkliste

Promotion - Banner
Pr Rank - xXx - Pr Rank
Pr Rank - Banner - Navi

pr-navi.de|||aaa||| Sex xXx fick Erotik sexy hardcore | | sex
ountry Frankreich value Avoriaz data country Frankreich value Deauville data country Frankreich value Cabourg data country Frankreich value Vaux-sur-Mer data country Frankreich value Saint-Pierre-la-Mer data country Frankreich value Bandol data country Frankreich value Le Lavandou data country Frankreich value Saint-Rapha u00ebl data country Frankreich value Porto-Vecchio data country Frankreich value Mallorca data country Spanien value Costa Blanca data country Spanien value Costa Brava data country Spanien value Costa Dorada data country Spanien value Barcelona data country Spanien value Lloret de Mar data country Spanien value Madrid data country Spanien value Marbella data country Spanien value Llan u00e7 u00e0 data country Spanien value Roses data country Spanien value Empuriabrava data country Spanien value L u2019Escala data country Spanien value Pals data country Spanien value Salou data country Spanien value Miami Playa data country Spanien value Costa del Azahar data country Spanien value D u00e9nia data country Spanien value X u00e0bia data country Spanien value Calp data country Spanien value Benidorm data country Spanien value Torrevieja data country Spanien value Costa del Sol data country Spanien value Nerja data country Spanien value Estepona data country Spanien value Menorca data country Spanien value Korfu data country Griechenland value Kreta data country Griechenland value Rhodos data country Griechenland value Zakynthos data country Griechenland value Chalkidiki data country Griechenland value Thasos data country Griechenland value Pag data country Kroatien value Krk data country Kroatien value Istrien data country Kroatien value Novi Vinodolski data country Kroatien value Dubrovnik data country Kroatien value Umag data country Kroatien value Pore u010d data country Kroatien value Pula data country Kroatien value Medulin data country Kroatien value Rab data country Kroatien value Novigrad data country Kroatien value Zadar data country Kroatien value Vir data country Kroatien value Vodice data country Kroatien value Bra u010d data country Kroatien value Algarve data country Portugal value Costa Verde data country Portugal value Lissabon data country Portugal value Sintra data country Portugal value Portim u00e3o data country Portugal value Albufeira data country Portugal value Madeira data country Portugal value Azoren data country Portugal value Teneriffa data country Kanarische Inseln value La Palma data country Kanarische Inseln value Lanzarote data country Kanarische Inseln value Fuerteventura data country Kanarische Inseln value Gran Canaria data country Kanarische Inseln value Zillertal data country u00d6sterreich value Kitzb u00fchel data country u00d6sterreich value Salzburger Land data country u00d6sterreich value Tirol data country u00d6sterreich value Wien data country u00d6sterreich value Limfjord data country D u00e4nemark value Vinderup data country D u00e4nemark value Sp u00f8ttrup data country D u00e4nemark value Fars u00f8 data country D u00e4nemark value Thyholm data co zilien city new sizilien else if city Sodankylä city new sodankylae else if city Sölvesborg city new soelvesborg else if city Sogndal city new sogndal else if city Sotkamo city new sotkamo else if city Split city new split else if city Spttrup city new spoettrup else if city Spreewald city new spreewald else if city Strömstad city new stroemstad else if city St Moritz city new st-moritz else if city Taipeh city new taipeh else if city Tel Aviv city new tel-aviv else if city Teneriffa city new teneriffa else if city Thasos city new thasos else if city Thüringer Wald city new thueringer-wald else if city Thyholm city new thyholm else if city Tignes city new tignes else if city Tirol city new tirol else if city Torrevieja city new torrevieja else if city Toulouse city new toulouse else if city Turin city new turin else if city Umag city new umag else if city Usedom city new usedom else if city Uusimaa city new uusimaa else if city Valencia city new valencia else if city Val-dEUR Illiez city new val-d-illiez else if city Val Thorens city new val-thorens else if city Varsinais-Suomi city new varsinais-suomi else if city Vaucluse city new vaucluse else if city Vaux-sur-Mer city new vaux-sur-mer else if city Venedig city new venedig else if city Venetien city new venetien else if city Verbier city new verbier else if city Versilia city new versilia else if city Villars-sur-Ollon city new villars-sur-ollon else if city Vinci city new vinci else if city Vinderup city new vinderup else if city Vir city new vir else if city Vodice city new vodice else if city Warschau city new warschau else if city Weissenhäuser Strand city new weissenhaeuser-strand else if city Wien city new wien else if city X bia city new xabia else if city Zadar city new zadar else if city Zakynthos city new zakynthos else if city Zeeland city new zeeland else if city Zermatt city new zermatt else if city Zillertal city new zillertal else if city Zürich city new zuerich else if city Zweisimmen city new zweisimmen else if city Zypern city new zypern else city new berlin header search attr action de city new i s o g r a m i GoogleAnalyticsObject r i r i r i r q i r q push arguments i r l 1 new Date a s o m s getElementsByTagName o 0 a async 1 a src g m parentNode insertBefore a m window script www google-analytics comanalytics js create UA-24705569-1 auto send pageview d w c w c w c push try w yaCounter18696181 new Ya Metrika id 18696181 webvisor true clickmap true trackLinks true accurateTrackBounce true catch e n d getElementsByTagName 0 s d script f n parentNode insertBefore s n s type s async true s src d location https ? http mc yandex rumetrikawatch js if w opera object Opera d addEventListener DOMContentLoaded f false else f window yandex metrika callbacks tmr push id 2521185 type pageView start new Date getTime d w ts d script ts type ts async true ts src d location https ? http top-fwz1 mail rujscode js f s d getElementsByTagName 0 s parentNode insertBefore ts s if w opera object Opera d addEventListener DOMContentLoaded f false else f windo Apartments Ferienwohnungen und Unterkünfte finden und günstig buchen gaq push setAccount UA-24705569-1 gaq push trackPageview type async true src location ? ssl http www google-analytics comga js s getElementsByTagName 0 s parentNode insertBefore s und 61456 Deutsch English P Espaol Italiano Franais Dansk Nederlands Vermieter So funktioniert es! Facebook Twitter YouTube Google Gäste 1 Gast2 Gäste3 Gäste4 Gäste5 Gäste6 Gäste7 Gäste8 Gäste9 Gäste10 Gäste11 Gäste12 Gäste13 Gäste14 Gäste und 61440 Suchen Hamburg Berlin München Bodensee Kitzbühel Gardasee Bretagne Paris Normandie Landes Cte d Azur Vaucluse Mallorca Barcelona Madrid Costa Brava Costa Dorada Costa Blanca Costa Verde Lissabon Algarve La Palma Teneriffa Gran Canaria Fuerteventura Lanzarote Zypern Korfu Kreta Rhodos Pag Istrien Krk Novi Vinodolski Ligurien Sardinien Korsika Sizilien Apulien Rom Istanbul London Edinburgh Budapest Krakau Tel Aviv Moskau Sankt Petersburg Deutschland Hamburg Müritz Spreewald Bayerischer Wald Mecklenburgische Seenplatte Harz Eifel Aachen Thüringer Wald Hunsrück Schwarzwald Oberbayern Allgäu Nordsee Nordfriesische Inseln Ostfriesland Dithmarschen Cuxhaven Norddeich Ostsee Rügen Usedom Damp Fischland-Darß-Zingst Mecklenburger Bucht Weissenhäuser Strand Österreich Zillertal Kitzbühel Salzburger Land Tirol Wien Schweiz Genfersee Zermatt St Moritz Davos Verbier Leukerbad Städtereisen Barcelona Madrid Pisa Rom Venedig Florenz Rimini London Moskau Sankt Petersburg Prag Saint-Tropez Dubrovnik Budapest Spanien Costa Brava Costa Blanca Costa Dorada Costa del Sol Costa del Azahar Mallorca Menorca Marbella Lloret de Mar La Palma Teneriffa Fuerteventura Lanzarote Gran Canaria Frankreich La Bresse le-de-France Saint-Malo Les Sables-dEUR Olonne le dEUR Olron Biarritz Saint-Jean-de-Luz Capbreton Le Grau-du-Roi Cap dEUR Agde Canet-Plage Provence Val Thorens Chamonix Italien Lago Maggiore Luganersee Comer See Ledrosee Lombardei Dolomiten Friaul-Julisch Venetien Emilia-Romagna Chianti Amalfiküste Halbinsel von Sorrent Kalabrien Rosolina Mare Kroatien Istrien Novi Vinodolski Pag Krk Umag PoreÄ Pula Medulin Rab Novigrad Zadar Vir Vodice BraÄ Griechenland Korfu Thasos Chalkidiki Rhodos Kreta Zakynthos Zypern Dänemark Limfjord Vinderup Spttrup Fars Thyholm Hjslev Roslev Lgstr Fan Rm Finnland Kuusamo Inari Kittilä Sodankylä Varsinais-Suomi Nilsiä Uusimaa Sotkamo Schweden Lysekil Strömstad Kungshamn Sölvesborg Falkenberg Norwegen seral Farsund Lindesnes Avery Sogndal Selje Beliebte Apartments MüritzDeutschland 33 71 EUR Nordfriesische InselnDeutschland 51 29 EUR LigurienItalien 36 64 EUR OstfrieslandDeutschland 42 71 EUR MüritzDeutschland 95 48 EUR Gran CanariaSpanien 211 86 EUR Apartments Ferienwohnungen und Unterkünfte finden und günstig buchen und 61479 Wir bieten für zahlreiche beliebte Reiseziele in ganz Europa eine große Auswahl an preiswerten Unterkünften Besonders begehrt sind unsere Berlin Apartments und Ferienwohnungen in München Für Touristen stellen unsere Unterkünfte eine tolle Möglichkeit dar die schönen Metropolen zu besuchen Unsere else if city Ascona city new ascona else if city seral city new aseral else if city Avery city new averoey else if city Avoriaz city new avoriaz else if city Azoren city new azoren else if city Bali city new bali else if city Bandol city new bandol else if city Bangkok city new bangkok else if city Barcelona city new barcelona else if city Bayerischer Wald city new bayerischer-wald else if city Benidorm city new benidorm else if city Berlin city new berlin else if city Biarritz city new biarritz else if city Bocas del Toro city new bocas-del-toro else if city Bodensee city new bodensee else if city BraÄ city new brac else if city Breslau city new breslau else if city Bretagne city new bretagne else if city Budapest city new budapest else if city Buenos Aires city new buenos-aires else if city Cabourg city new cabourg else if city Calp city new calp else if city Canet-Plage city new canet-plage else if city Cannes city new cannes else if city Capbreton city new capbreton else if city Cap dEUR Agde city new cap-d-agde else if city Castelnuovo Berardenga city new castelnuovo-berardenga else if city Castiglione del Lago city new castiglione-del-lago else if city Cavalaire-sur-Mer city new cavalaire-sur-mer else if city Chalkidiki city new chalkidiki else if city Chamonix city new chamonix else if city Chianti city new chianti else if city Comer See city new comer-see else if city Costa Blanca city new costa-blanca else if city Costa Brava city new costa-brava else if city Costa del Azahar city new costa-del-azahar else if city Costa del Sol city new costa-del-sol else if city Costa Dorada city new costa-dorada else if city Costa Paradiso city new costa-paradiso else if city Costa Rei city new costa-rei else if city Costa Verde city new costa-verde else if city Cte d Azur city new cote-dazur else if city Crans-Montana city new crans-montana else if city Cuxhaven city new cuxhaven else if city Damp city new damp else if city Danzig city new danzig else if city Davos city new davos else if city Deauville city new deauville else if city Dnia city new denia else if city Dithmarschen city new dithmarschen else if city Dolomiten city new dolomiten else if city Dubai city new dubai else if city Dubrovnik city new dubrovnik else if city Edinburgh city new edinburgh else if city Eifel city new eifel else if city Emilia-Romagna city new emilia-romagna else if city Empuriabrava city new empuriabrava else if city Engelberg city new engelberg else if city Ernen city new ernen else if city Estepona city new estepona else if city Falkenberg city new falkenberg else if city Fan city new fanoe else if city Fars city new farsoe else if city Farsund city new farsund else if city Fischland-Darß-Zingst city new fischland-darss-zingst else if city Florenz city new florenz else if city Friaul-Julisch Venetien city new friaul-julisch-venetien else if city Fuerteventura city new fuerteventura else if city Gardasee city new gardasee else if city Genfersee city new genfersee else if city Ghisonaccia city new ghisonaccia else if city Gozo city new gozo else if city Grächen city new graechen else if city Granada city new granada else if city Gran Canaria city new gran-canaria else if city Grindelwald city new grindelwald else if city Halbinsel von Sorrent city new halbinsel-von-sorrent else if city Hamburg city new hamburg else if city Harz city new harz else if city Hjslev city new hoejslev else if city Hunsrück city new hunsrueck else if city le-de-France city new ile-de-france else if city le dEUR Olron city new ile-d-oleron else if city Inari city new inari else if city Isola Rossa city new isola-rossa else if city Istanbul city new istanbul else if city Istrien city new istrien else if city Kalabrien city new kalabrien else if city Kapstadt city new kapstadt else if city Kiew city new kiew else if city Kittilä city new kittilae else if city Kitzbühel city new kitzbuehel else if city Korfu city new korfu else if city Korsika city new korsika else if city Krakau city new krakau else if city Kreta city new kreta else if city Krk city new krk else if city Kungshamn city new kungshamn else if city Kuusamo city new kuusamo else if city Lacanau city new lacanau else if city Lago Maggiore city new lago-maggiore else if city Landes city new landes else if city Lanzarote city new lanzarote else if city Lauchernalp city new lauchernalp else if city La Bresse city new la-bresse else if city La Grande-Motte city new la-grande-motte else if city La Palma city new la-palma else if city Ledrosee city new ledrosee else if city Les Arcs city new les-arcs else if city Les Menuires city new les-menuires else if city Les Sables-dEUR Olonne city new les-sables-d-olonne else if city Leukerbad city new leukerbad else if city Le Corbier city new le-corbier else if city Le Grau-du-Roi city new le-grau-du-roi else if city Le Lavandou city new le-lavandou else if city Ligurien city new ligurien else if city Limfjord city new limfjord else if city Lindesnes city new lindesnes else if city Lissabon city new lissabon else if city Llan city new llanca else if city Lloret de Mar city new lloret-de-mar else if city Locarno city new locarno else if city Lgstr city new loegstoer else if city Lombardei city new lombardei else if city London city new london else if city Luganersee city new luganersee else if city Lugano city new lugano else if city Luzern city new luzern else if city Lyon city new lyon else if city Lysekil city new lysekil else if city LEUR Escala city new l-escala else if city Madeira city new madeira else if city Madrid city new madrid else if city Mailand city new mailand else if city Mallorca city new mallorca else if city Marbella city new marbella else if city Marseille city new marseille else if city Maui city new maui else if city Mecklenburger Bucht city new mecklenburger-bucht else if city Mecklenburgische Seenplatte city new mecklenburgische-seenplatte else if city Medulin city new medulin else if city Melbourne city new melbourne else if city Menorca city new menorca else if city Miami city new miami else if city Miami Playa city new miami-playa e Ferienwohnungen sind komfortabel und modern eingerichtet Internet WLAN und neue Flachbildfernseher lassen keine Wünsche eines kurzen aber auch langen Aufenthalts offen Ein weiterer Kostenvorteil gegenüber Hotels oder Pensionen entsteht durch die umfangreich ausgestatteten Küchen der Ferienwohnungen Dadurch können unsere Gäste ihre eigenen gesunden Mahlzeiten zubereiten und Geld sparen Die zentrale Lage unserer Unterkünfte Apartments am Checkpoint Charlie Unterkunft am Potsdamer Platz Mitte Ferienwohnungen in München Hauptbahnhof und die Nähe zu den interessantesten Sehenswürdigkeiten Brandenburger Tor Fernsehturm Zoologischer Garten von Berlin und München sind bemerkenswert Unsere Gäste können ihre Zeit nutzen um die interessantesten Museen und Veranstaltungen Grüne Woche Berlinale IFA Berlin Marathon Silvester zu besuchen oder auf eigene Faust die Szenebezirke Mitte Friedrichshain Kreuzberg Prenzlauer Berg der Hauptstadt erkunden So funktioniert es! und 61440 1 Unterkunft suchen Finden Sie eine passende Unterkunft und 61484 2 Unterkunft buchen Ihre Unterkunft direkt und einfach buchen und 61444 3 Direkter Kontakt Gast und Vermieter stehen im direkten Kontakt Wählen Sie aus über 300 Apartments Ihre Berlin Unterkunft Go-apartments bietet für jeden Berlinbesucher eine günstige Ferienwohnung Unsere Gäste können aus über 300 Ferienwohnungen in den besten Lagen der Hauptstadt Ihre Unterkunft wählen Buchen auch Sie für Ihre nächste Reise ein günstiges Apartment und entdecken Sie den besonderen Charme dieser Stadt Von einem 1-Zimmer in Mitte im Herzen von Berlin für Alleinreisende 5-Zimmer am Potsdamer Platz für Reisegruppen oder Familien bis hin zu gehoben ausgestatteten Maisonetten mit eigener Terrasse und Garten in Mitte findet der Gast eine passende Unterkunft Kundenbewertungen Die Wohnung bietet ausreichend Platz für viele Personen jeder hat seinen eigenen Raum wenn gewünscht Zu gemütlichen Abenden lädt sowohl das Wohnzimmer als auch der Balkon ein Ausstattung ist modern viel Fläche für Familien Einteilung der Zimmer ist ideal Aufzug vorhanden schöner Ausblick auf Berlin! Das Einchecken hat problemlos geklappt Das Kinderbett war trotz Vorinformation nicht vorhanden wurde aber umgehend nachgeliefert Die Ausstattung der gesamten Wohnung war sehr angenehm Die Möbel sind modern und stilvoll man bekommt wirklich eine Atmosphäre wie zu Hause alles ist wohnlich eingerichtet Urlaub in Europa Die schönste Zeit des Jahres verbringen viele am liebsten in Europa - bevorzugt im sonnigen Süden Viele Reisende zieht es im Urlaub in die Sonne Landschaftlich schöne Inseln wie Mallorca Kreta Korfu oder Zypern stehen auf der Beliebtheitsskala ganz oben Hier wird der Reisende mit Sonne satt verwöhnt dazu gibt es traumhafte Strände Kultur und mediterranes Flair Wer es gerne ein bisschen individueller mag wählt als Unterkunft anstelle eines Hotels eine Ferienwohnung oder ein Ferienhaus Hierbei ist man unabhängiger und kann den Urlaub auch abseits des großen Touristentrubels genießen Große und überfüllte Hotels sind nicht mehr belie tschland value Schwarzwald data country Deutschland value Oberbayern data country Deutschland value Allg u00e4u data country Deutschland value Gardasee data country Italien value Sardinien data country Italien value Ligurien data country Italien value Sizilien data country Italien value Pisa data country Italien value Apulien data country Italien value Florenz data country Italien value Rimini data country Italien value Rom data country Italien value Venedig data country Italien value Lombardei data country Italien value Lago Maggiore data country Italien value Luganersee data country Italien value Comer See data country Italien value Ledrosee data country Italien value Dolomiten data country Italien value Friaul-Julisch Venetien data country Italien value Venetien data country Italien value Rosolina Mare data country Italien value Emilia-Romagna data country Italien value Abruzzen data country Italien value Vinci data country Italien value Reggello data country Italien value Chianti data country Italien value Montaione data country Italien value Monte San Savino data country Italien value San Gimignano data country Italien value Castelnuovo Berardenga data country Italien value Versilia data country Italien value Siena data country Italien value Castiglione del Lago data country Italien value Amalfik u00fcste data country Italien value Kalabrien data country Italien value Isola Rossa data country Italien value Costa Paradiso data country Italien value Porto Cervo data country Italien value San Teodoro data country Italien value Costa Rei data country Italien value Halbinsel von Sorrent data country Italien value Bretagne data country Frankreich value C u00f4te d Azur data country Frankreich value Normandie data country Frankreich value Landes data country Frankreich value Korsika data country Frankreich value Paris data country Frankreich value Vaucluse data country Frankreich value u00cele-de-France data country Frankreich value La Bresse data country Frankreich value Picardie data country Frankreich value Saint-Malo data country Frankreich value Les Sables-d u2019Olonne data country Frankreich value u00cele d u2019Ol u00e9ron data country Frankreich value Biarritz data country Frankreich value Saint-Jean-de-Luz data country Frankreich value Capbreton data country Frankreich value Lacanau data country Frankreich value Port Camargue data country Frankreich value Le Grau-du-Roi data country Frankreich value La Grande-Motte data country Frankreich value Cap d u2019Agde data country Frankreich value Canet-Plage data country Frankreich value Saint-Cyprien data country Frankreich value Provence data country Frankreich value Saint-Cyr data country Frankreich value Cavalaire-sur-Mer data country Frankreich value Saint-Tropez data country Frankreich value Sainte-Maxime data country Frankreich value Ghisonaccia data country Frankreich value Tignes data country Frankreich value Les Menuires data country Frankreich value Val Thorens data country Frankreich value Le Corbier data country Frankreich value Chamonix data c lse if city Montaione city new montaione else if city Monte San Savino city new monte-san-savino else if city Moskau city new moskau else if city Müritz city new mueritz else if city München city new muenchen else if city Mykonos city new mykonos else if city Naxos city new naxos else if city Nedstrand city new nedstrand else if city Nendaz city new nendaz else if city Nerja city new nerja else if city New York city new new-york else if city Nilsiä city new nilsiae else if city Nizza city new nizza else if city Norddeich city new norddeich else if city Nordfriesische Inseln city new nordfriesische-inseln else if city Normandie city new normandie else if city Novigrad city new novigrad else if city Novi Vinodolski city new novi-vinodolski else if city Oberbayern city new oberbayern else if city Orlando city new orlando else if city Ostfriesland city new ostfriesland else if city Ovronnaz city new ovronnaz else if city Pag city new pag else if city Pals city new pals else if city Paris city new paris else if city Peking city new peking else if city Picardie city new picardie else if city Pisa city new pisa else if city PoreÄ city new porec else if city Portimo city new portimao else if city Porto Cervo city new porto-cervo else if city Porto-Vecchio city new porto-vecchio else if city Port Camargue city new port-camargue else if city Port Douglas city new port-douglas else if city Prag city new prag else if city Provence city new provence else if city Pula city new pula else if city Queenstown city new queenstown else if city Rab city new rab else if city Reggello city new reggello else if city Rhodos city new rhodos else if city Rimini city new rimini else if city Rm city new roemoe else if city Rom city new rom else if city Roses city new roses else if city Roslev city new roslev else if city Rosolina Mare city new rosolina-mare else if city Rügen city new ruegen else if city Saas-Fee city new saas-fee else if city Saas-Grund city new saas-grund else if city Sainte-Maxime city new sainte-maxime else if city Saint-Cyprien city new saint-cyprien else if city Saint-Cyr city new saint-cyr else if city Saint-Jean-de-Luz city new saint-jean-de-luz else if city Saint-Malo city new saint-malo else if city Saint-Pierre-la-Mer city new saint-pierre-la-mer else if city Saint-Raphal city new saint-raphael else if city Saint-Tropez city new saint-tropez else if city Salou city new salou else if city Salzburger Land city new salzburger-land else if city Sankt Petersburg city new sankt-petersburg else if city Santiago city new santiago else if city Santorin city new santorin else if city San Gimignano city new san-gimignano else if city San Teodoro city new san-teodoro else if city So Paulo city new sao-paulo else if city Sardinien city new sardinien else if city Schwarzwald city new schwarzwald else if city Selje city new selje else if city Seoul city new seoul else if city Sevilla city new sevilla else if city Shanghai city new shanghai else if city Siena city new siena else if city Sintra city new sintra else if city Si untry D u00e4nemark value H u00f8jslev data country D u00e4nemark value Roslev data country D u00e4nemark value L u00f8gst u00f8r data country D u00e4nemark value Fan u00f8 data country D u00e4nemark value R u00f8m u00f8 data country D u00e4nemark value Istanbul data country T u00fcrkei value Prag data country Tschechien value Edinburgh data country Gro u00dfbritannien value London data country Gro u00dfbritannien value Moskau data country Russland value Sankt Petersburg data country Russland value Falkenberg data country Schweden value Lysekil data country Schweden value Str u00f6mstad data country Schweden value Kungshamn data country Schweden value S u00f6lvesborg data country Schweden value Nedstrand data country Norwegen value u00c5seral data country Norwegen value Farsund data country Norwegen value Lindesnes data country Norwegen value Aver u00f8y data country Norwegen value Sogndal data country Norwegen value Selje data country Norwegen value Kuusamo data country Finnland value Inari data country Finnland value Kittil u00e4 data country Finnland value Sodankyl u00e4 data country Finnland value Varsinais-Suomi data country Finnland value Nilsi u00e4 data country Finnland value Uusimaa data country Finnland value Sotkamo data country Finnland value Budapest data country Ungarn value Villars-sur-Ollon data country Schweiz value Genfersee data country Schweiz value Val-d u2019Illiez data country Schweiz value Ovronnaz data country Schweiz value Verbier data country Schweiz value Nendaz data country Schweiz value Saas-Grund data country Schweiz value Saas-Fee data country Schweiz value Lauchernalp data country Schweiz value Zermatt data country Schweiz value Gr u00e4chen data country Schweiz value Leukerbad data country Schweiz value Crans-Montana data country Schweiz value Ernen data country Schweiz value Zweisimmen data country Schweiz value Grindelwald data country Schweiz value Luzern data country Schweiz value Engelberg data country Schweiz value Locarno data country Schweiz value Ascona data country Schweiz value Lugano data country Schweiz value St Moritz data country Schweiz value Davos data country Schweiz value Z u00fcrich data country Schweiz value Krakau data country Polen value Breslau data country Polen value Gozo data country Malta value Tel Aviv data country Israel value Zypern data country Zypern value New York data country Amerika value Bocas del Toro data country Panama input region devbridgeAutocomplete lookup suggestions groupBy country input region focusout flagExistsLoop 0 for i in suggestions check flag if suggestions i value this val flagExistsLoop 1 break if flagExistsLoop 0 this val Stadt im Header gewählt region focusout e link header search attr action city region val if city Aachen city new aachen else if city Abruzzen city new abruzzen else if city Albufeira city new albufeira else if city Algarve city new algarve else if city Allgäu city new allgaeu else if city Amalfiküste city new amalfikueste else if city Amsterdam city new amsterdam else if city Apulien city new apulien bt Günstige Ferienwohnungen befinden sich auch auf Mallorca an der spanischen Küste Costa Brava oder in der Normandie Diese sind meist etwas ruhiger gelegen und man kann das landestypische Leben hautnah erleben Wer nicht zwingend den Urlaub am Meer verbringen will für den könnte auch ein Aufenthalt in einer Ferienwohnung am Gardasee als idealer Urlaub dienen Dieser See in traumhafter Lage zieht jedes Jahr etliche Besucher in seinen Bann Wer hingegen dem Winter entfliehen möchte wählt vielleicht ein Ferienhaus auf Teneriffa als Reiseziel aus Das ganze Jahr über angenehme Temperaturen von 20 bis 28 C schöne Strände und eine kurze Flugzeit von nur 4 Stunden machen diese Insel zu einem Ganzjahresziel Vor allem um die Weihnachtszeit und an Fasching ist in Teneriffa Hochsaison Reisende die rechtzeitig ihren Urlaub buchen finden eine große Auswahl an schönen und preiswerten Ferienwohnungen Für jeden Geschmack ist etwas dabei! Mit der Wahl einer passenden Unterkunft wird der Urlaub erholsam und schön 412 Bewertungen mit 4 6 von 5 Sternen Go-apartments Über Uns Kontakt AGB Impressum Für Vermieter So funktioniert es Sichere Bezahlung Zahlungsmethoden Go-apartments 2014 Go-apartments KONTAKTIEREN SIE UNS! Tel 49 30 498068-02 Mo - Fr 9 00-18 00 Uhr Fax 49 30 9203720-26 Merken Entfernen ready Kalender datepicker setDefaults datepicker regional ger dates arrival departure datepicker dateFormat dd mm yy monthNames Januar Februar März April Mai Juni Juli August September Oktober November Dezember dayNames Sonntag Montag Dienstag Mittwoch Donnerstag Freitag Samstag dayNamesMin So Mo Di Mi Do Fr Sa changeMonth false changeYear false minDate new Date onSelect selectedDate option this id arrival ? minDate maxDate instance this data datepicker parseDate instance settings dateFormat datepicker defaults dateFormat selectedDate instance settings dates not this datepicker option date if this id arrival endDay new date getTime 259200000 departure val datepicker formatDate dd mm yy endDay suggestions value Berlin data country Deutschland value M u00fcnchen data country Deutschland value Hamburg data country Deutschland value Bodensee data country Deutschland value M u00fcritz data country Deutschland value Bayerischer Wald data country Deutschland value Spreewald data country Deutschland value Ostfriesland data country Deutschland value Nordfriesische Inseln data country Deutschland value Dithmarschen data country Deutschland value Mecklenburger Bucht data country Deutschland value Fischland-Dar u00df-Zingst data country Deutschland value R u00fcgen data country Deutschland value Usedom data country Deutschland value Damp data country Deutschland value Weissenh u00e4user Strand data country Deutschland value Cuxhaven data country Deutschland value Norddeich data country Deutschland value Mecklenburgische Seenplatte data country Deutschland value Harz data country Deutschland value Eifel data country Deutschland value Aachen data country Deutschland value Th u00fcringer Wald data country Deutschland value Hunsr u00fcck data country Deu | go-apartments.de
|
Apartments Ferienwohnungen und g nstige Unterk nfte schnell und einfach finden Buchen Sie eine Unterkunft ab 19 pro Person
1. go-apartments.de PR-Navi.de
2. go-apartments.de PR-Navi.de

sex
Sex xXx fick Erotik sexy hardcore | | godyo.de | Mit ber 25 Jahren Erfahrung im IT Umfeld bieten wir hoch qualifizierte Beratungsleistungen und konzipieren speziell auf unsere Kunden zugeschnittene IT und Software L sungen | n entwickeln nicht nur die maßgeschneiderte Software für Ihr Unternehmen sondern bauen Ihnen auch Ihr IT-System und unterstützen Sie mit Live-Support und zentralen Ansprechpartnern kontinuierlichem Monitoring und Reporting Wir sind GODYO EUR wir sind Ihr Partner in einem dynamischen und globalisierten Markt! News Veranstaltungen Kundenmagazin 24 08 2016 TECH after Work EURHPE Data Protector EUR Die Neuerungen in der PraxisEUR im Rückblick Die neue Version des HPE Data Protector 9 07 ist seit kurzem ITInfrastrukturClient-SystemePartner HerstellerReferenzenIT-ServiceOutsourcingSupport und ServiceMittelstandscloudReferenzenUnternehmenUnternehmensphilosophieUnternehmensstrukturChronikAktuellesPresseEngagementKarriereKontaktAGBImpressum Aktuelles Branchen Lösungen Strategische Partner GODYO EUR We make smarter Mit über 25 Jahren Erfahrung im IT-Umfeld bieten wir hoch qualifizierte Beratungsleistungen und konzipieren speziell auf unsere Kunden zugeschnittene IT- und Software-Lösungen Unsere Experte cht sind unsere Mitarbeiter Tagtäglich tragen sie Wissen Werte und Wertschöpfung in unser Unternehmen So gestalten sie nicht nur unsere Erfolgsgeschichte sondern auch die unserer Kunden und Partner Teamgeist und Identifikation sind nicht nur in unseren Abläufen spürbar sie fließen direkt und profitabel in Kundenprojekte ein EUR für gemeinsames Wachsen aus gemeinsamer Verantwortung mit gemeinsamer Begeisterung für die Vielfalt von IT-Lösungen Wir bauen intelligente Strukturen ebnen Wege für Visionen aktImpressumAGBDatenschutzerklärungDrucken We make smarter IT-ConsultingIT-Infrastructure ConsultingBusiness SoftwareProjektmanagementReferenzenIT-ApplicationsERPIndividualsoftwareSoftwaretechnologieEntwicklungsprozessReferenzenIT-InfrastructureZentrale ITInfrastrukturClient-SystemePartner HerstellerReferenzenIT-ServiceOutsourcingSupport und ServiceMittelstandscloudReferenzenUnternehmenUnternehmensphilosophieUnternehmensstrukturChronikAktuellesPresseEngagementKarriereKontaktAGBImpressum KontaktKarr verfügbar Zahlreiche IT-Verantwortliche nutzten am Donnerstag dem 18 August 2016 die Gelegenheit und holten sich ein Wissens-Update für ihre tägliche Arbeit Lesen Sie mehr 23 06 2016 1 GODYO Partner Lounge Rückblick Premiere einer neuen Partnerkommunikationsplattform im Restaurant Bauersfeld im Zeiss-PlanetariumLesen Sie mehr Alle News anzeigen 10 08 2016 15 09 2016 09 00 bis 10 00 Webinar Veeam Availability Suite 9 5 Volle Integration mit Windows Server 2016 und Hyper-V-TechnologienLesen Sie mehr istik MittelstandsMAIL Projektmanagement Fertigungsunternehmen Business Software Projektmanagement Serviceprovider Web Hoster Server Storage Wohnungsgesellschaften Zentrale IT-Infrastructure Health Care Medizintechnik Individualsoftwareentwicklung IT-Infrastructure Lösungen Archivierung Backup Recovery Betriebssysteme Clients Datenbanken ERP-System GODYO P4 Individualsoftware Mobile Apps Netzwerk Server Storage Virtualisierung zur Partnerwebseite IT-Consulting We make succeed IT-Applications We mak Möchten Sie sich regelmäßig über aktuelle technologische Entwicklungen neue Produkte und Neuigkeiten aus unserer Unternehmensgruppe informieren? Dann bestellen Sie doch einfach unser Kundenmagazin Sie bekommen es dann regelmäßig 2 3x im Jahr per Post zugesandt Neueste Ausgabe ansehen Archiv Kundenmagazin abonnieren Kundenmagazin abbestellen Branchen Öffentliche Auftraggeber Public Backup IT-Infrastructure Stadtwerke Energieversorger Mittelstand Storage und Backup Energie EUR Storage und Backup Log e communicate IT-Infrastructure We make work IT-Service We make run GODYO-Story Die GODYO-Unternehmensgruppe ist ein führender Anbieter für IT-Lösungen und Dienstleistungen Mit unserer to Business-Strategie entwickeln wir wertsteigernde zukunftssichere IT-Lösungen die exakt zu den Unternehmenszielen zur Branche und zum jeweiligen Geschäftsmodell unserer Kunden passen und deren komplexe Prozesse strukturieren beschleunigen und intelligent gestalten We make smarter Karriere bei GODYO Was uns stark ma und die Zukunft Mehr Informationen IT-ConsultingIT-Infrastructure ConsultingBusiness SoftwareProjektmanagementReferenzenIT-ApplicationsERPIndividualsoftwareSoftwaretechnologieEntwicklungsprozessReferenzenIT-InfrastructureZentrale ITInfrastrukturClient-SystemePartner HerstellerReferenzenIT-ServiceOutsourcingSupport und ServiceMittelstandscloudReferenzenUnternehmenUnternehmensphilosophieUnternehmensstrukturChronikAktuellesPresseEngagementKarriereKontaktAGBImpressum 2016 GODYO-Unternehmensgruppe Kont We make smarter GODYO gaq push setAccount UA-31564170-1 gaq push setDomainName godyo com gaq push type async true src location ? ssl http www google-analytics comga js s getElementsByTagName 0 s parentNode insertBefore s tx kiwiaccordion exclusive 1 tx kiwiaccordion effect slide KontaktKarriereSucheSitemap IT-ConsultingIT-Infrastructure ConsultingBusiness SoftwareProjektmanagementReferenzenIT-ApplicationsERPIndividualsoftwareSoftwaretechnologieEntwicklungsprozessReferenzenIT-InfrastructureZentrale

| 1. PR-Navi.de godyo.de
2. PR-Navi.de godyo.de



goerlich-pharma.de
Die Goerlich Pharma GmbH ist Ihr kompetenter Partern f r Lohnherstellung und Verpackung von Nahrungserg nzungsmitteln Di tetischen Lebensmitteln Erg nzenden bilanzierten Di ten und Futtererg nzungsmitteln | 108 und 105 und 99 und 104 und 45 und 112 und 104 und 97 und 114 und 109 und 97 und 46 und 99 und 111 und 109Internet www goerlich-pharma com kontakt impressum agb datenschutzerklä Goerlich Pharma GmbH gaq push setAccount UA-32067556-1 gaq push gat anonymizeIp gaq push trackPageview type async true src location ? ssl http www google-analytics comga js s getEle l Ergänzungsfuttermitteln Unser Erfolg gründet auf unserem Engagement Die Zusammenarbeit mit unseren Kunden und Partnern beruht auf Vertrauen welches wir schaffen und pflegen Goerli Hartkapseln2-Phasen-KapselnTablettenSticksÖlmischungen Lohnherstellung Blister und FaltschachtelnDosen und GläserAbfüllung von LiquidaBefüllung von Sticks Verpackungsservice Pflanzl ch Pharma GmbH Am Gewerbering 4 683533 Edling Deutschland Tel 49 0 8071-9083-0Fax 49 0 8071-9083-29 e-Mail und 105 und 110 und 102 und 111 und 64 und 103 und 111 und 101 und 114 und bH ist ein inhabergeführtes Unternehmen gegründet 1984 mit Hauptsitz in Edling südöstlich von München Unsere Kernkompetenz Service und bdquo Alles aus einer Hand und ldquo ! Entwick lung Lohnherstellung Verpackung von und bull Nahrungsergänzungsmitteln und bull Diätetischen Lebensmitteln und bull Ergänzenden bilanzierten Diäten und bull Medizinprodukten und bul mentsByTagName 0 s parentNode insertBefore s de en fr TeamLeistungsspektrumQualitätProduktionUmwelt und EnergieSoziale VerantwortungJobsAusbildung Unternehmen WeichkapselnKaukapseln iche HartkapselnHartgelatinekapselnWeichgelatinekapselnÖle pflanzlichen UrsprungsÖle in Flaschen abgefülltMarine Omega-3 KonzentrateÖl-PulverTablettenKaukapseln -tablettenGranulatmi schungen zur Stickabfüllung Basisprodukte Condition Specific FormulasPurity I Quality I Innovation EPAX Omega-3BioPlus Algenöl Willkommen Goerlich Pharma GmbH Die Goerlich Pharma Gm | Sex xXx fick Erotik sexy hardcore |
sex
1. goerlich-pharma.de PR-Navi.de
2. PR-Navi.de goerlich-pharma.de

| DedicatedServer Intel Core i3 i5 i7 4 - 16GB DDR3 RAM Up to 1TB SATA2 HDD Unm tNode insertBefore s Simpler More Reliable Servers! Introducing a NEW Way of red Trademark of INLINE Internet Online Dienste GmbH All Rights Reserved ss Greater Rellability Provides more freedom at a LOWER COSTS Catering the fo ion ? ssl http www google-analytics comga js s getElementsByTagName 0 s paren ush setAccount UA-28500642-1 gaq push trackPageview type async true src locat HOSTING! home who we are products technology latest news contact tos imprint etered Bandwidth German Datacenter Cloud VPS Empowered Hosting Full Root Acce llowing Brands Testimonials Powered by WHMCompleteSolution GOWEB is a registe Dedicated Server Hosting Virtual Private Server Cheap VPS Hosting GoWEB gaq p

sex
| Sex xXx fick Erotik sexy hardcore | goweb.de | Dedicated server hosting at GoWeb saves you the trouble of contacting technical support every now an then We also offer Cheap VPS hosting and Virtual Private server It provides the most efficient hosting services
1. goweb.de PR-Navi.de
2. goweb.de PR-Navi.de

ektion und messe dich mit anderen Spielern weltweit Live Rennen direkt vom Kommandostand! Schl u00fcpfe bei Miramagia die Rolle eines Druiden Schamanen Magiers oder Hexers und lasse mit Hilfe deiner Zauberkunst mystische Pflanzen und Gew u00e4chse deinem Garten gedeihen Travian ist das preisgekr u00f6nte internationale Strategiespiel der Antike Beginne als u00e4uptling deines kleinen Dorfes u00fcnde weitere u00fchre Kriege oder handele friedlich mit deinen Nachbarn u00e4mpfe dich mithilfe deiner u00fcndnispartner die Spitze Errichte dein Eisenbahn-Imperium Browser! Schlie u00dfe dich mit anderen Spielern zusammen baue dein Streckennetz aus und werde der einflussreichste Tycoon u00fcber sechs spannende Zeitepochen! moregamesUrls games traviang altenden Spielspaß garantieren northworks Software GmbH published Travian Games GmbH Impressum AGB northworks Software GmbH published Travian Games GmbH Bosanski EUR Portugus English tina Deutsch Dansk Espaol Suomi Franais Hrvatski Magyar Italiano Nederlands Norsk Polski Portugus EUR RomnÄ Svenska Slovenski slovenÄ ina Türke Nam Impressum Travian Games GmbH Wilhelm-Wagenfeld-Straße Munich Germany Amtsgericht München HRB Ust-Id Geschäftsführer Lars Janssen Telefon kein Spielsupport Fax nur für Plussupport Jugendschutzbeauftragter Rechtsanwalt Andreas Lober BEITEN BURKHARDT Rechtsanwaltsgesellschaft mbH youthprotection traviangames com Robin Houben privacy traviangames com Bei Supportanfragen bitte immer Spielername Spielwelt angeben Alle Recht ames com114381000001300DEU29 games traviangames com114381000001300DEU14 games traviangames com114381000001300DEU30 games traviangames com114381000001300DEU22 subPages main gametour trailer why moregames about new Image src finalimgtrailer grafik hover png Site showRegistrationPopup errors html regform css opacity css display css opacity animate opacity regform animate opacity hideRegistrationPopup regform animate opacity regform css display none Post send form sendForm form window location sendForm form url regform button css display none css display type POST url data form serialize dataType json success data success window location href data sso else html each data errors key val html val css display none regform button css display errors h auf dein Team zum Sieg u00fchren Taktik-Schulungen u00e4higkeiten-Training oder Konditionstraining? bestimmst was trainiert wird Entwickle deine Spieler und mache aus jungen Talenten echte Megastars Die richtige Zusammenstellung des Kaders geh u00f6rt deinen wichtigsten Aufgaben Alte Haudegen aufstrebende Talente oder eine bunte Mischung? Viele Wege u00fchren zum Ziel! Durch gezielte Eink u00e4ufe auf dem Echtzeit-Transfermarkt kannst deinen Kader schnell verst u00e4rken oder dir junge Talente sichern Verfolge jede Minute deiner Mannschaft Live-Ticker Kann sie sich gegen deine Kontrahenten durchsetzen? moregamesTitles UnitedGP Miramagia Travian Kingdoms Rail Nation moregamesTexts Entwickle als Teamchef eines Rennstalls deinen Boliden zur Perf e Texten Grafiken und Quellcode liegen bei der northworks Software GmbH badges-shown data appstore xxx appstore removeAttr href appstoreButton css display inline-block appstore-comingsoon show data playmarket xxx playmarket removeAttr href playmarketButton css display inline-block playmarket-comingsoon show gametourTitles Stadionumfeld Aufstellung Training Kader Transfer Live-Ticker gametourTexts Sorge u00fcr das beste Trainingsgel u00e4nde eine Jugendakademie und eine hervorragende medizinische Abteilung Deine Fans danken dir u00dferdem eine gute Infrastruktur sowie Imbissbuden oder Restaurants u00e4hle eine passende Formation u00fcr deine Spieler entscheide u00fcber eine offensive oder defensive Ausrichtung und stelle die passenden Spieler e als Teamchef eines Rennstalls deinen Boliden zur Perfektion und messe dich mit anderen Spielern weltweit Live Rennen direkt vom Kommandostand! Jetzt spielen Start Gametour Trailer Warum PRO? Weitere Spiele Über uns Start Gametour Trailer Warum PRO? Weitere Spiele northworks Software GmbH Entwicklung und der Betrieb von Online-Sportspielen mit Tiefgang sind die obersten Ziele der Hamburg basierten northworks Software GmbH Weltweit werden die Titel von hunderttausenden Spielern gespielt Travian Games GmbH Travian Games ist einer der weltweit führenden Anbieter für browserbasierte Online-Spiele Das Unternehmen bietet seinen Kunden weltweit komplexe und vielschichtige Erlebniswelten die durch ihre Spieltiefe überzeugen und den Anwendern langanh goalunited PRO youtubeId HokZm0 2HRA fbq callMethod? callMethod apply arguments queue push arguments fbq push loaded version queue async src parentNode insertBefore window connect facebook neten fbq init fbq PageView JETZT anmelden und sofort losspielen! AGB und akzeptieren Ich bin damit einverstanden von der Travian Games GmbH über interessante Spielinformationen und Neuigkeiten informiert werden Jetzt spielen DER FUSSBALLMANAGER Start Gametour Trailer Warum PRO? Weitere Spiele Über uns Start Gametour Trailer Warum PRO? Weitere Spiele Über uns Jetzt spielen Schon registriert? Login Start Gametour Trailer Warum PRO? Weitere Spiele Über uns Gametour Start Trailer Warum PRO? Weitere Spiele Über uns Stadionumfeld Sorge für das beste Trainingsgel eine sehr komplexe Berechnung der Matches Ausführliches Kader-Management Mit einem ausgeklügelten Kader-Management-System formst eine Mannschaft mit Titelambitionen und findest die richtige Mischung aus Charakteren jungen Stars und alten Hasen Umfassender Live-Transfermarkt Auf dem Echtzeit-Transfermarkt kannst dein Team durch gezielte Käufe schnell und übersichtlich verstärken Herausforderndes Jugend-System Zeige den anderen und forme eine talentierte Jugendmannschaft die schon bald deinen Profikader verstärkt Start Gametour Trailer Warum PRO? Weitere Spiele Über uns Weitere Spiele Start Gametour Trailer Warum PRO? Über uns UnitedGP Entwickle als Teamchef eines Rennstalls deinen Boliden zur Perfektion und messe dich mit anderen Spielern wel ände eine Jugendakademie und eine hervorragende medizinische Abteilung Deine Fans danken dir außerdem eine gute Infrastruktur sowie Imbissbuden oder Restaurants Start Gametour Trailer Warum PRO? Weitere Spiele Über uns Trailer Start Gametour Warum PRO? Weitere Spiele Über uns Start Gametour Trailer Warum PRO? Weitere Spiele Über uns Warum PRO? Start Gametour Trailer Weitere Spiele Über uns Unglaubliche Langzeit-Spieltiefe goalunited PRO ist ein Fußballmanager mit einzigartiger und komplexer Spieltiefe die eine Langzeitmotivation bietet wie kein anderes Management-Spiel Kompromissloser Realismus goalunited PRO wird von seinen Spielern für den einmaligen und ausgefeilten Realismus geliebt Detaillierte Spielberechnung goalunited PRO verfügt über tweit Live Rennen direkt vom Kommandostand! Jetzt spielen Miramagia Schlüpfe bei Miramagia die Rolle eines Druiden Schamanen Magiers oder Hexers und lasse mit Hilfe deiner Zauberkunst mystische Pflanzen und Gewächse deinem Garten gedeihen Jetzt spielen Travian Kingdoms Travian ist das preisgekrönte internationale Strategiespiel der Antike Beginne als Häuptling deines kleinen Dorfes gründe weitere führe Kriege oder handele friedlich mit deinen Nachbarn Kämpfe dich mithilfe deiner Bündnispartner die Spitze Jetzt spielen Rail Nation Errichte dein Eisenbahn-Imperium Browser! Schließe dich mit anderen Spielern zusammen baue dein Streckennetz aus und werde der einflussreichste Tycoon über sechs spannende Zeitepochen! Jetzt spielen UnitedGP Entwickl
Sex xXx fick Erotik sexy hardcore
| | goalunited.de
Der ultimative Fuballmanager f r Experten
Sparen |
1. PR-Navi.de goalunited.de
2. PR-Navi.de goalunited.de

Sparen | Diese Website steht zum Verkauf gothicorgien de ist die beste Quelle f r alle Informationen die Sie suchen Von allgemeinen Themen bis hin zu speziellen Sachverhalten finden Sie auf gothicorgien de alles Wir hoffen dass Sie hier das Gesuchte finden
|

!normalize css v1 MIT License git ionormalize article aside details figcaption figure footer header hgroup main nav section summary display block audio canvas video display inline-block display inline zoom audio not controls display none hidden display none html font-size -ms-text-size-adjust -webkit-text-size-adjust html button input select textarea font-family sans-serif body focus outline thin dotted active hover outline font-size abbr title dotted strong font-weight bold blockquote margin dfn italic -moz-box-sizing content-box box-sizing content-box mark FF0 color pre code kbd pre samp font-family mono dient top b6dff6 a8cfe6 -o-linear-gradient top b6dff6 a8cfe6 -ms-linear-gradient top b6dff6 a8cfe6 linear-gradient bottom b6dff6 a8cfe6 filter progid Microsoft gradient startColorstr b6dff6 endColorstr a8cfe6 GradientType solid DCECF5 text-align left content position relative padding float none text-align left overflow hidden left display none center float left right float right margin-top footer position relative text-align left clear both FFF color font-size header domain float left header domain color font-size font-weight bold letter-spacing -1px text-decoration none text-transform lowercase overflow hi le button disabled html input disabled cursor default input type radio box-sizing input type -webkit-appearance textfield -moz-box-sizing content-box -webkit-box-sizing content-box box-sizing content-box input type -webkit-appearance none button -moz-focus-inner input -moz-focus-inner textarea overflow auto vertical-align top table collapse header content footer left center right webarchive overflow hidden sense help text-decoration none!important div privacy policy display none div privacy policy link cursor div privacy policy link div privacy policy text-align center margin-top div privacy policy solid C0 coration none gothicorgien Diese Website steht zum Verkauf! Informationen zum Thema gothicorgien und window location href und rendered html get php msg file line window onerror ads label Sponsored Links onclick param onclick value onclick param onclick value onclick param posredir onclick param ww5 gothicorgien php?ses csa csn did ww5 gothicorgien pus ses phl Beliebte Kategorien blank tlt prs warl Weitere Links wapi img sedoparking comtemplatesbrick gfxportal icons waac wabc true alternatePubId dp-sedo81 pdto caf transparent pubId dp-sedo81 domainRegistrant as-drid-2439427412437576 gothicorgien adtest off n dden word-wrap break-word header float right margin-top header buyBox position absolute top right E8F4FA padding z-index solid CCC none buyBox font-size font-weight bold color buyBox font-size color buyBox color text-decoration none buyBox hover text-decoration underline ads webarchive container center rlblock center right vertical text-align right disclaimer dotted D9D9D9 padding disclaimer color text-decoration underline imprint text-align center dotted D9D9D9 padding imprint font-size color text-decoration underline div privacy policy link font-size padding color text-decoration underline disclaimer hove oAds uiOptimize true channel tmplt-005 exp-0051 exp-0093 auxa-control-1 gothicorgien Weitere LinksDomain erwerbenSie können die Domain gothicorgien kaufen!Der Inhaber dieser Domain parkt diese beim Domain-Parking-Programm Die auf dieser Seite bereitgestellten Listings kommen von dritter Seite und stehen mit Domain-Inhaber oder Sedo keiner Beziehung Bei markenrechtlichen Problemfällen wenden Sie sich bitte direkt den Domain-Inhaber Whois Denic cafEl meta layoutTypes caf container ads type ads lines blank transparent true rolloverLinkBold rolloverLinkColor rolloverLinkUnderline true verticalSpacing afs comdp- sedobullet justads gif colorTitleLink titleBold true noTitleUnderline colorText colorDomainLink meta layoutTypes caf container rlblock right type number transparent true rolloverLinkBold rolloverLinkUnderline true noTitleUnderline true colorTitleLink meta layoutTypes caf container rlblock center type number columns transparent true rolloverLinkBold rolloverLinkColor rolloverLinkUnderline true noTitleUnderline true afs comdp-sedobullet justads gif titleBold true colorTitleLink meta layoutTypes caf container type true tmpl test ? document new obj print push apply arguments with obj push replace t g split C0C0 padding dose12 position absolute top -500px disclaimer font-size disclaimer sedologo float left disclaimer link disclaimer visited text-decoration underline disclaimer active disclaimer focus disclaimer hover text-decoration underline rlblock left empty rlblock right empty rlblock center empty rlblock mobile empty display none body font-size font-family Arial Helvetica Verdana Lucida Grande sans-serif text-align center header zoom B6DFF6 url data imagesvg xml base64 -moz-linear-gradient top b6dff6 a8cfe6 -webkit-gradient linear left top left bottom color-stop b6dff6 color-stop a8cfe6 -webkit-linear-gra r disclaimer active disclaimer focus imprint hover imprint active imprint focus div privacy policy link focus div privacy policy link hover div privacy policy link active text-decoration none position relative float left webarchive popular categories color font-family Arial sans-serif font-size font-weight bold text-align left webarchive portal margin-bottom webarchive portal font-size font-weight bold margin-bottom webarchive portal color text-decoration none webarchive portal color font-size font-weight bold text-decoration underline webarchive portal active center portal focus center portal hover text-de space serif font-family courier new monospace font-size pre white-space pre-wrap word-wrap break-word quotes none before after content none small font-size sup font-size position relative vertical-align baseline sup top bottom menu none nav none img -ms-interpolation-mode bicubic svg not root overflow hidden figure form fieldset none padding legend white-space normal margin-left -7px button input select textarea font-size vertical-align middle button input normal button select text-transform none button html input type button input type reset input type submit -webkit-appearance button cursor overflow visib | Sex xXx fick Erotik sexy hardcore | gothicorgien.de | 1. PR-Navi.de gothicorgien.de
2. PR-Navi.de gothicorgien.de

| | Sex xXx fick Erotik sexy hardcore
n aus dem Festnetz der Deutschen Telekom aus den Mobilfunknetzen gelten U höhere Tarife go avs Altersverifikation und Jugendschutzsystem Kontakt AGB Impressum Startseite Registri tzt registrieren Login Benutzerkonto freischalten Mobilfunk und Internet jugendgeschützt? Mit einer einmaligen und sicheren Registrierung erhalten Sie Ihre persönliche go avs-Iden Jugendschutz Internet und Mobilfunk bedeutet was der Name sagt Kinder und Jugendliche werd en vor potentiell schädlichen Inhalten geschützt Mehr zum Jugendschutz Internet und bull E tität und damit Zugriff auf attraktive Internet- und Mobilfunk-Angebote unserer Partner Je -Mail support goavs und bull Hotline und bull powered verify-U und bull Kennung --- EuroMi eren Mein go avs Partner Angebote Häufige Fragen Downloads Jugendschutz Über go avs Willko mmen bei go avs Online Personenidentifikation und Altersverifikation für die digitale Welt
|
| goavs.de
1. PR-Navi.de goavs.de
2. goavs.de PR-Navi.de

| | gob.de
NPOunitop Versorgungunitop Infrastrukturunitopunitop 4sureÜber unsMehr Wert5 Gründe für die GOBKompetenzen und AuszeichnungenCloudWas ist Cloud?Was ist Microsoft Azure?unitop 365Office 365RechtlichesProdukteMicrosoft Dynamics NAVMicrosoft SharePointTARGIT Decision SuiteAktuellesNewsWebinareMessen und EventsPresseKontaktAnfahrtDatenschutzImpressumKarriereSchülerStudierende und HochschulabsolventenBerufserfahreneOffene Stellen Impressum Datenschutz AnfahrtGOB Software und Systeme GmbH und Co KG und bull Europark Fichtenhain A4 und bull D-47807 Krefeld Kontaktieren Sie uns 49 2151 349 3000 Diese Seite verwendet Cookies weitere Informationen finden Sie hier hr erfahren UNITOP ERP INDUSTRIE Kunststoffverarbeitung Metallverarbeitung Servicecenter Variantenfertigung Mehr erfahren UNITOP NPO Akademie Fundraising Kammer Verband Mehr erfahren UNITOP INFRASTRUKTUR Software IT-Infrastruktur Beratung Mehr erfahren UNITOP VERSORGUNG Betriebliche Altersversorgung Pensionskasse Versorgungswerk Mehr erfahren Sind Sie Cloud-Ready? Wir bringen Sie sicher in die Cloud! Hier erfahren Sie die wichtigsten Fakten zur Cloud GOB - Ihre Cloud Experten alles aus einer Hand - Support inklusive WEITERE INFOS MICROSOFT AZURE Was ist Azure Mehr erfahren INFRASTRUKTUR DIENSTLEISTUNGEN Software IT-Infrastruktur Beratung Mehr erfahren M hutzProdukteMicrosoft Dynamics NAVÜbersichtHistorie10 Gründe für NAVLizenzverfahrenERP von A-ZMicrosoft SharePointÜbersichtLeistungenReferenzenIT-InfrastrukturTARGIT Decision SuiteÜbersichtLeistungenAktuellesNewsWebinareMessen und EventsPressePresse-BilderClippingsKarriereSchülerAusbildungDuales StudiumSchülerpraktikumBewerbungstippsStudierende und HochschulabsolventenBachelor- und MasterthesisTrainee IT-ConsultantTrainee VertriebFAQsBerufserfahreneIT-ConsultantTechnical ConsultantMicrosoft Dynamics NAV ConsultantVertriebsbeauftragteFAQsOffene Stellen Von 10 00 - 12 00 Uhr Kontakt Xing - Unternehmensseite GOB YouTube Channel DeEn Mobiles Arbeiten mit Of die voller Zukunft stecken! In unserem inhabergeführten innovativen und dynamischen Arbeitsumfeld bieten wir Ihnen die idealen Rahmenbedingungen für den gemeinsamen langfristigen Erfolg Bringen Sie mit Ihren Ideen Ihre Entwicklung und die Entwicklung unserer Lösungen voran Wenn Sie als Teamplayer die offene Kommunikation pflegen sind Sie bei uns genau richtig Wir suchen kluge Köpfe voller Begeisterung! WEITERE INFOS VEREINBAREN SIE JETZT EINE KOSTENLOSE ERSTBERATUNG Wir klären auf Einsatzszenarien von Cloud-Lösungen für den Mittelstand contact root Formular Vorname Nachname Telefon Email Branchen und Lösungenunitop ERP Handelunitop ERP Industrieunitop Erfolgskurs Mit mehr als 270 Mitarbeitern sowie 1 000 nationalen und internationalen Projekten zählt die GOB heute zu den größten und erfolgreichsten Microsoft Dynamics NAV-Partnern weltweit Wirklich außergewöhnlich ist jedoch ihre Ganzheitlichkeit Die GOB überzeugt mit ganzheitlicher Kompetenz und ganzheitlichem Angebot Das Ergebnis sind passgenaue und hoch qualitative Lösungen die alle Komponenten der IT umfassen Software Hardware und Support Sie sehen diese Ganzheitlichkeit ist für Sie vor allem eins mehr Wert Lernen Sie uns kennen! UNITOP 4 SURE IT-Projektmanagement Mehr erfahren UNITOP ERP HANDEL Multichannel Technischer Großhandel Versandhandel Me ERP-Software auf Basis von Microsoft Dynamics NAV GOB function push gtm start new Date getTime gtm dataLayer ? und async true src www googletagmanager comgtm js?id dl parentNode insertBefore window document script dataLayer GTM-MMGWJ4 script document script script async true script type textjavascript src https www gob dechatserver php?a a138b und rqst track und output jcrpt und fbpos 10 und fbml und fbmt und fbmr und fbmb und fbw 50 und fbh 218 und nse Math random setTimeout script src document getElementById livezilla tracking appendChild script 1 FernwartungKundenportalNoch Fragen? Von 10 00 - 12 00 Uhr Kontakt Xing - Unternehmensseite GOB YouTube Ch fice 365! Mobiles Arbeiten vonHeute und Morgen! Los gehts Business Intelligence Daten Auswertenleicht gemacht! Los gehts Erfolgreich in Ihre Karriere starten! Ist Ihr Talent noch nicht entdeckt worden? Los gehts Portallösungen fürjede Unternehmung! Up to date miteinem Intranet! Los gehts Was ist ERP? Warum brauchen Sie ein ERP - System? Los gehts Was ist Microsoft Dynamics NAV? Wissenswertes zu Microsoft Dynamics NAV! Los gehts UNITOP - Die ganzheitliche ERP-Software für den Mittelstand Wir bringen Sie sicher in die Cloud! Hier erfahren Sie die wichtigsten Fakten zur Cloud GOB - Ihre Cloud Experten alles aus einer Hand - Support inklusive Seit 1965 auf annel HomeBranchen und Lösungenunitop ERP HandelMultichannelÜbersichtLeistungenIT-InfrastrukturTechnischer GroßhandelÜbersichtLeistungenReferenzenIT-InfrastrukturVersandhandelÜbersichtLeistungenReferenzenIT-Infrastrukturunitop ERP IndustrieKunststoffverarbeitungÜbersichtLeistungenIT-InfrastrukturMetallverarbeitungÜbersichtLeistungenIT-InfrastrukturServicecenterÜbersichtLeistungenIT-InfrastrukturVariantenfertigungÜbersichtLeistungenIT-Infrastrukturunitop NPOAkademieÜbersichtLeistungenReferenzenIT-InfrastrukturFundraisingÜbersichtLeistungenReferenzenIT-InfrastrukturKammerÜbersichtLeistungenReferenzenIT-InfrastrukturVerbandÜbersichtLeistungenReferenzenIT-I nfrastrukturunitop VersorgungPensionskasseÜbersichtLeistungenReferenzenIT-InfrastrukturBetriebliche AltersversorgungÜbersichtLeistungenReferenzenIT-InfrastrukturVersorgungswerkÜbersichtLeistungenReferenzenIT-Infrastrukturunitop InfrastrukturunitopMarkeKonzeptLizenzierung5 Gründe für unitopMobiles Arbeitenunitop 4sureIT-ProjektmanagementÜber unsMehr Wert5 Gründe für die GOBKompetenzen und AuszeichnungenCloudWas ist Cloud?Was ist Microsoft Azure?unitop 365Die Cloud für KMUsunitop 365 Konzeptunitop 365 MieteOffice 365Was ist Office 365?Office 365 - FunktionenErfahrungsberichte Office 365RechtlichesDatenschutzDatenschutz in der CloudFragen zum Cloud Datensc ICROSOFT OFFICE 365 Was ist Office 365 Funktionen Erfahrungsberichte Mehr erfahren MICROSOFT SHAREPOINT Übersicht Leistungen Referenzen IT-Infrastruktur Mehr erfahren TARGIT DECISION SUITE Übersicht Leistungen Mehr erfahren MICROSOFT DYNAMICS NAV Übersicht Historie 10 Gründe für NAV Lizenzverfahren ERP von A-Z Mehr erfahren Was ist Cloud? Wie sicher ist die Cloud? Wo liegen meine Daten? Passt die Cloud zu mir und meinem Unternehmen? Wie finde ich den passenden Cloudanbieter und worauf sollte ich achten? Wie lang dauert es in die Cloud zu migrieren? Warum GOB und Cloud? Was kostet die Cloud? Soll ich mit meinem Unternehmen in die Cloud? Wir bieten Themen | Sex xXx fick Erotik sexy hardcore | Arbeit Beruf Karriere Arbeiten Ausland Arbeitskleidung Arbeitslosigkeit Arbeitspolitik Arbeitssicherheit Arbeitssucht Beratung Service Berufe Berufswahl Bewerbung Training Bewerbungen Familie Freiberufler Grundeinkommen Hartz Headhunter Messen Kongresse Mobbing Organisationen Zukunft der Bildung Schulen Unterricht Uni Hochschule Fachhochschule Studium Akademien Hochschulen Weiteres Internate Kurse Nachhilfe Lern Software Internet Kommunikation | Entdecken Sie die ERP Software von der GOB unitop ist Microsoft Dynamics NAV zertifiziert und deckt Ihre Bed rfnisse ab Hier informieren |
1. PR-Navi.de gob.de
2. PR-Navi.de gob.de

IBG - Goeke Technology Group ibg-i Unternehmen Goeke Technology Technologien Lösun AktuellMessetermineFachartikelNewsletterGoeke Group Gourmet Menü Kontakt ready if javascript g defer true g async true g src piwik js s parentNode insertBefore g s rame fancybox zoomSpeedIn zoomSpeedOut overlayShow true titleShow autoScale type i tSiteId 1 d g d createElement script s d getElementsByTagName script 0 g type text frame iPROCELL GREENTEC AWARDS MOVING TECHNOLOGY ERÖFFNET HMI ready iframe fancybo aq push location ? http stats ibg-com paq push setTrackerUrl piwik php paq push se TECHNOLOGY GROUP - MEDIA Impressum - - Rechtliche Hinweise - IBG Automation GmbH p gen AutomotiveGreen TechnologyWindkraftMedizintechnik PharmaLuftfahrtLogistik News x zoomSpeedIn zoomSpeedOut overlayShow true titleShow autoScale type iframe GOEKE | goeke-group.de
| Umsetzung menschlicher Genialit t in technische Perfektion | | | Sex xXx fick Erotik sexy hardcore

1. goeke-group.de PR-Navi.de
2. PR-Navi.de goeke-group.de


| goodeggs.de | Hier entsteht
o padding-top text-align left font-size Diese neue Domain wurde Kundenauftrag registriert Warum wird diese Seite angezeigt? Diese Seite wurde automatisch erstellt Sie wird bei jeder neuen Domain hinterlegt und zeigt dass die neue Domain erreichbar ist Ohne diese Platzhalter-Seite würden Besucher eine Fehlermeldung erhalten Als Kunde von unite ize color fff font-weight normal content-wrapper margin auto text-align center fff content margin auto fff font-size text-align left footer-wrapper f0f2f3 footer margin aut imagesevolutionudag logo png url www united-domains deimagesevolutionudag logo svg url www united-domains deimagesevolutionudag logo png Hide text overflow hidden text-inde ink dvLink hover dvLink visited dvLink focus url www united-domains deassetsimgiconslink-arrow png right center no-repeat padding-right text-decoration none font-weight nor dern united-domains Die besten Adressen fürs Web Weitere Domains günstig registrieren Neue Domain-Endungen vorbestellen Impressum united-domains AG Alle Rechte vorbehalten d-domains können Sie diese Domain Ihrem Domain-Portfolio jederzeit selbst online konfigurieren Web-Weiterleitungen E-Mail-Einstellungen Webspace hinzubuchen DNS-Einträge än html body height margin padding FFF font-family Arial Verdana sans-serif body text-align center f0f2f3 spacerTop margin-top link hover visited focus margin padding dvLink l mal color dvLink hover text-decoration underline dvLink no-ico none padding logo-wrapper fff logo margin auto height left center no-repeat contain url www united-domains de nt -9999px font-size color rgba text-align left logo img none logo-href display block height header-wrapper header margin auto text-align left font-size title margin font-s |
Sex xXx fick Erotik sexy hardcore | | 1. PR-Navi.de goodeggs.de
2. PR-Navi.de goodeggs.de

renberg Bergen auf Rügen Berlin Burg Haldensleben Halle Leipzig Luckenwalde Magdeburg Staßfurt Stendal Stuttgart Tangermünde Zeitz Zerbst Modern EUR Kompetent EUR Zuverlässig Wir sind modern Unser Anspruch ist Punkto Ausbildung Büroausstattung und Technik auf dem neuesten Stand sein Sie erhalten von uns ein Maximum Leistungsfähigkeit Wir sind kompetent Unser großes Team aus Steuerberatern Wirtschaftsprüfern und Rechtsanwälten bietet Ihnen Lösungen für die alltäglichen Fragen des Wirtschaftslebens Wir begleiten Sie auch bei Spezialthemen wie Fördermittel Internationales Steuerrecht Landwirtschaft Nachfolge Sanierung oder Insolvenz Wir sind zuverlässig Auf uns können Sie sich verlassen Wir halten was wir versprechen Aktuelles Sommerfest feierte die GOB Unternehmensgruppe ihr traditionelles Sommerfest und lud dazu alle Mitarbeiter nach Aschersleben das Lieblingsobjekt EURGrauer HofEUR ein Vorab durften die Mitarbeiter aus verschiedenen Programmpunkten wählen Zur Auswahl standen ein Kabarett zum Thema EUREinen Mann Mehr lesen Newsletter ready span close teaser click newsletter teaser visible invisible fadeOut GOB Steuerberatungsgesellschaft mbH Vorderbreite D-06449 Aschersleben Telefon Fax 8884-23 E-Mail info gob-stbg Kontakt Anfahrt Impressum Newsletter arallax yorigin xorigin yparallax xparallax tree yorigin xorigin yparallax xparallax apples yorigin xorigin yparallax xparallax glow yorigin xorigin yparallax xparallax text1 yorigin xorigin yparallax xparallax text1 ready imagefilm click overlay fadeIn imagefilm fadeIn black header fadeIn css opacity myPlayer imagefilm myPlayer play overlay click overlay fadeOut imagefilm fadeOut black header fadeOut myPlayer imagefilm myPlayer pause window width newsletter teaser visible window div newsletter teaser fadeIn div newsletter teaser fadeOut newsletter teaser fadeOut newsletter teaser offset top newsletter teaser wrapper-footer offset top newsletter teaser css position absolute window wrapper-footer offset top newsletter teaser css position fixed restore when you sub-menu mouseover div gob-submenu-inner hidden css z-index sub-menu mouseleave div gob-submenu-inner hidden css z-index gob-submenu-inner hidden each this mouseover window width tTemp this attr dataId tTemp css color fff css opacity this mouseleave window width tTemp this attr dataId tTemp css color css opacity tTemp ready div gob-submenu-inner hidden css bottom gob-submenu-inner css Mehr dazu Steuerberatung Mehr dazu Rechtsberatung Mehr dazu Wirtschaftsprüfung Gob Standorte Aschersleben Bad Dür play inline-block width no-repeat cover language-chooser margin-top language-chooser first-of-type url wp-contentthemesstairwayimageslanguage jpg margin-left language-chooser nth-of-type url wp-contentthemesstairwayimageslanguage jpg language-chooser nth-of-type url wp-contentthemesstairwayimageslanguage jpg language-chooser span display none language-chooser display inline-block width Deutsch English GOB Über GOB Standorte Aschersleben Bad Dürrenberg Bergen auf Rügen Berlin Burg Haldensleben Halle Leipzig Luckenwalde Magdeburg Staßfurt Stendal Tangermünde Zeitz Zerbst Karrierewelt Arbeitgeber Stellenangebote Bewerbungsbogen Ausbildung Erfahrungsbericht Fachkräfte Erfahrungsbericht Führungskräfte Erfahrungsbericht Leistungsbereiche GOB-Steuerberatung Finanzbuchhaltung Jahresabschluss Steuererklärung Lohnbuchhaltung Branchen Gesundheit und Pflege Handwerk und Baugewerbe Hotels und Gastronomie Landwirtschaft GOB-Rechtsberatung Unternehmensnachfolge GOB-Wirtschaftsprüfung GOB-Begleitungsberatung Internationales Steuerrecht Nachfolgeberatung Kooperationen Mandantenbereich Aktuelles Mandanten-Rundschreiben Video Tipps Steuerrechner Fernbetreuung Unternehmen Online Downloads Feedback Veranstaltungen Newsletter ready parallax-layer parallax decay mouseport p menu-container fff solid dadada color responsive-menu-container -ms-input-placeholder color c7c7cd responsive-menu-container -webkit-input-placeholder color c7c7cd responsive-menu-container -moz-placeholder color c7c7cd opacity responsive-menu-container -moz-placeholder color c7c7cd opacity responsive-menu-container responsive-menu-item-link responsive-menu-container responsive-menu-title responsive-menu-container responsive-menu-subarrow transition responsive-menu-container responsive-menu-title color fff font-size responsive-menu-container responsive-menu-title color fff text-decoration none responsive-menu-container responsive-menu-title hover color fff responsive-menu-container responsive-menu-title hover color fff responsive-menu-container responsive-menu-title hover color fff responsive-menu-container responsive-menu-title responsive-menu-title-image display inline-block vertical-align middle margin-right responsive-menu-container responsive-menu responsive-menu-item responsive-menu-item-link font-size responsive-menu-container responsive-menu responsive-menu-item solid fff color fff responsive-menu-container responsive-menu responsive-menu-item hover color fff responsive-menu-container responsive-menu responsive-menu-item hover responsive-menu- tom responsive-menu-open responsive-menu-container transform translateY -ms-transform translateY -webkit-transform translateY -moz-transform translateY responsive-menu-container before responsive-menu-container after responsive-menu-container before responsive-menu-container after box-sizing margin padding responsive-menu-container responsive-menu-additional-content responsive-menu-container responsive-menu-title padding responsive-menu-container responsive-menu width responsive-menu-container responsive-menu responsive-menu-submenu display none responsive-menu-container responsive-menu responsive-menu-submenu responsive-menu-submenu-open display block responsive-menu-container responsive-menu responsive-menu-submenu-depth-1 responsive-menu-item-link padding-left responsive-menu-container responsive-menu responsive-menu-submenu-depth-2 responsive-menu-item-link padding-left responsive-menu-container responsive-menu responsive-menu-submenu-depth-3 responsive-menu-item-link padding-left responsive-menu-container responsive-menu responsive-menu-submenu-depth-4 responsive-menu-item-link padding-left responsive-menu-container responsive-menu responsive-menu-submenu-depth-5 responsive-menu-item-link padding-left responsive-menu-container responsive-menu res GOB Unternehmensgruppe wrapper container main-content width wrapper content-headline width wrapper wrapper-header header-image url www gob-stbg dewp-contentuploads201605headerbild jpg window baseUrl org images core emoji ext png source concatemoji www gob-stbg wp-includes wp-emoji-release min js?ver canvas getContext und getContext String fromCharCode !g!g fillText return!1 switch textBaseline top font Arial case fillText toDataURL length case diversity fillText getImageData data fillText getImageData data case simple fillText getImageData data case unicode8 fillText getImageData data return!1 src type head appendChild for Array simple unicode8 diversity supports everything qtranxs url www gob-stbg png no-repeat qtranxs url www gob-stbg png no-repeat qtranxs url www gob-stbg png no-repeat recentcomments display inline !important responsive-menu-button responsive-menu-container display none -webkit-text-size-adjust media screen and responsive-menu-container display block responsive-menu-container position fixed top bottom z-index padding-bottom margin-bottom -5px overflow-y auto overflow-x hidden responsive-menu-container width padding -webkit-appearance none responsive-menu-container push-left responsive-menu-container transform translateX -100 -ms-t subarrow color fff responsive-menu-container responsive-menu responsive-menu-item responsive-menu-subarrow width color solid fff responsive-menu-container responsive-menu responsive-menu-item responsive-menu-subarrow hover color fff responsive-menu-container responsive-menu responsive-menu-item responsive-menu-current-item responsive-menu-item-link color fff responsive-menu-container responsive-menu responsive-menu-item responsive-menu-current-item responsive-menu-item-link hover color fff push arguments new Date async src parentNode insertBefore window www create UA-45540413-1 gob-stbg send pageview ready mapped click div mapoverlay iframe attr src this attr href div mapoverlay css display block css opacity div mapoverlay click this css display none responsive-menu menu language-chooser none language-chooser display inline-block width no-repeat cover language-chooser margin-top language-chooser first-of-type url wp-contentthemesstairwayimageslanguage jpg margin-left language-chooser nth-of-type url wp-contentthemesstairwayimageslanguage jpg language-chooser nth-of-type url wp-contentthemesstairwayimageslanguage jpg language-chooser span display none language-chooser display inline-block width Deutsch English language-chooser none language-chooser dis ponsive-menu-submenu-depth-6 responsive-menu-item-link padding-left responsive-menu-container responsive-menu-item width none responsive-menu-container responsive-menu-item width display block text-decoration none padding position relative responsive-menu-container responsive-menu-item margin-right responsive-menu-container responsive-menu-item responsive-menu-subarrow position absolute right top bottom text-align center overflow hidden responsive-menu-container responsive-menu-item responsive-menu-subarrow margin-right responsive-menu-button responsive-menu-button-icon-inactive display none responsive-menu-button z-index display none overflow hidden responsive-menu-button img responsive-menu-label display inline-block font-weight margin vertical-align middle responsive-menu-accessible display inline-block responsive-menu-accessible responsive-menu-box display inline-block vertical-align middle responsive-menu-label responsive-menu-label-top responsive-menu-label responsive-menu-label-bottom display block margin auto media screen and responsive-menu-button display inline-block cursor transition-property opacity filter transition-duration linear font inherit color inherit text-transform none transparent margin overflow visible responsive-menu-button ho ransform translateX -100 -webkit-transform translateX -100 -moz-transform translateX -100 responsive-menu-open responsive-menu-container push-left responsive-menu-open responsive-menu-container transform translateX -ms-transform translateX -webkit-transform translateX -moz-transform translateX responsive-menu-container push-top responsive-menu-container transform translateY -100 -ms-transform translateY -100 -webkit-transform translateY -100 -moz-transform translateY -100 responsive-menu-open responsive-menu-container push-top responsive-menu-open responsive-menu-container transform translateY -ms-transform translateY -webkit-transform translateY -moz-transform translateY responsive-menu-container push-right responsive-menu-container transform translateX -ms-transform translateX -webkit-transform translateX -moz-transform translateX responsive-menu-open responsive-menu-container push-right responsive-menu-open responsive-menu-container transform translateX -ms-transform translateX -webkit-transform translateX -moz-transform translateX responsive-menu-container push-bottom responsive-menu-container transform translateY -ms-transform translateY -webkit-transform translateY -moz-transform translateY responsive-menu-open responsive-menu-container push-bot ver opacity responsive-menu-box width display inline-block position relative responsive-menu-inner display block top margin-top -2px responsive-menu-inner before responsive-menu-inner after width fff position absolute transition-property transform transition-duration ease responsive-menu-inner before responsive-menu-inner after content display block responsive-menu-inner before top -10px responsive-menu-inner after bottom -10px responsive-menu-boring responsive-menu-inner before responsive-menu-boring responsive-menu-inner after transition-property none responsive-menu-boring is-active responsive-menu-inner transform rotate responsive-menu-boring is-active responsive-menu-inner before top opacity responsive-menu-boring is-active responsive-menu-inner after bottom transform rotate -90deg responsive-menu-button width position fixed top left responsive-menu-button hover responsive-menu-button responsive-menu-box color fff responsive-menu-label color fff font-size responsive-menu-button display inline-block transition transform media screen and responsive-menu-container width left fff transition transform text-align left responsive-menu-container responsive-menu-wrapper fff responsive-menu-container responsive-menu-additional-content color fff responsive-
Sex xXx fick Erotik sexy hardcore | gob-stbg.de

| |
Sparen | 1. gob-stbg.de PR-Navi.de
2. PR-Navi.de gob-stbg.de

| rsor totalCount 2467 page 1 pageSize 7 pages 353 isSkipped false news asia controller segment article list segment article list config headline level 3 classes icon-region chi-jap text Chartanalysen Asien und Emerging Markets wrapper classes box-wrap clearfix tabs null single hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type author width null height null api limit 6 attributes body author slug commentCount teaser source externalUrl isSponsored filter attribute categories id values 12 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled true auto true classes button right icon-arrow-right text Zum Chartanalysen Asien und Emerging Markets Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 12 target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 2476 page 1 pageSize 6 pages 413 isSkipped false chart comments controller segment article list segment article list config headline level 3 classes icon-chart-line blocker text Charttechnische Kommentare wrapper classes box-wrap green clearfix tabs null single hot enabled true count 5 backgroundColor null classes null appendAuthor enabled false image enabled true type author width null height null api limit 7 attributes body author slug commentCount teaser source externalUrl isSponsored filter attribute categories id values 64 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled true auto false classes button right icon-arrow-right text Mehr aus Charttechnik Trading und Investments textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 64 1258 target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 9945 page 1 pageSize 7 pages 1421 isSkipped false topsflops controller segment instrument list segment instrument list config headline level 3 classes text chart interactionResize false height 216 width cols-6 enabled false mode current generators HighLowMarkers 6m config volume false legend true type mountain grid true width 458 height 216 adelement enabled false tabs dax selected true title DAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 133962 type include action topsflops order topsflops 4 4 resource instrument attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId topsflops-tab-dax panelId topsflops-panel-dax showactions true showDelayedIcon true ad null view segment instrument list view table html twig skipCols mdax title MDAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 133964 type include action topsflops order topsflops 4 4 resource instrument attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId topsflops-tab-mdax panelId topsflops-panel-mdax showactions true showDelayedIcon true ad null view segment instrument list view table html twig skipCols sdax title SDAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 304227 type include action topsflops order topsflops 4 4 resource instrument attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId topsflops-tab-sdax panelId topsflops-panel-sdax showactions true showDelayedIcon true ad null view segment instrument list view table html twig skipCols tecdax title TecDAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 133963 type include action topsflops order topsflops 4 4 resource instrument attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId topsflops-tab-tecdax panelId topsflops-panel-tecdax showactions true showDelayedIcon true ad null view segment instrument list view table html twig skipCols dow-jones title Dow Jones mode topsflops top 4 flop 4 api filter attribute componentOf id values 133965 type include action topsflops order topsflops 4 4 resource instrument attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId topsflops-tab-dow-jones panelId topsflops-panel-dow-jones showactions true showDelayedIcon true ad null view segment instrument list view table html twig skipCols nasdaq title Nasdaq mode topsflops top 4 flop 4 api filter attribute componentOf id values 133955 type include action topsflops order topsflops 4 4 resource instrument attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId topsflops-tab-nasdaq panelId topsflops-panel-nasdaq showactions true showDelayedIcon true ad null view segment instrument list view table html twig skipCols single null defaults item showactions true showDelayedIcon true ad null top 5 flop 5 mode current view segment instrument list view table html twig skipCols api resource instrument action list attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision title Tops Flops titleClass chart-line isSkipped false calendar controller segment economycalendar teaser segment economycalendar teaser config headline level 3 text Wirtschaftsdaten-Kalender classes icon-calendar defaults api resource appointment action list limit 5 filter attribute category id values 1 type include attributes title date isAllDay country iso2 iso3 regions last prognosis isImportant series title unit title reference title description order date asc item markUnequalDays true chart enabled true archiveButton enabled true text Wirtschaftsdaten-Kalender classes button right icon-arrow-right link wirtschaftsdaten-kalender empty disableChart true text Keine Eintr u00e4ge gefunden startDate now endDate 1 year wrapper classes box-wrap clearfix single api resource appointment action list limit 5 filter attribute category id values 1 type include attribute date values 2016-09-01T21 30 19 02 00 type greater and equal than attribute date values 2017-09-01T21 30 19 02 00 type less and equal than attributes title date isAllDay country iso2 iso3 regions last prognosis isImportant series title unit title reference title description order date asc markUnequalDays true chart enabled true archiveButton enabled true text Wirtschaftsdaten-Kalender classes button right icon-arrow-right link wirtschaftsdaten-kalender empty disableChart true text Keine Eintr u00e4ge gefunden startDate now endDate 1 year cursor totalCount null page 1 pageSize 5 pages null isSkipped false video announcement controller segment video announcement segment video announcement config title Video Announcement titleClass video text null placeholder null api resource broadcast attributes type user description isSponsored action list filter attribute isActive values 1 type include color yellow isSkipped false videos controller segment article list segment article list config headline level 3 classes icon-videos text Die neuesten Videos von GodmodeTrader wrapper classes box-wrap clearfix tabs null single horizontal enabled true columns 4 show title true author true comment true teaser false teaserOnImage false date true textOnImage true hot enabled true count 3 backgroundColor null classes null appendAuthor enabled false image enabled true type videoCover width 300 height 168 api limit 3 attributes id author autoTeaser slug specific video show commentCount source externalUrl isSponsored filter attribute categories id values 1947 1811 1261 1948 1822 2212 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled true auto true classes button right icon-arrow-right text Zum Archiv textDefault true link archiv-suche?tab search-archive-tab-articles und filter categories id 1947 1811 1261 1948 1822 2212 target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 4550 page 1 pageSize 3 pages 1517 isSkipped false medium rectangle controller segment ad segment ad config type medium-rectangle isSkipped false commodity currency controller segment article list segment article list config headline level 3 classes icon-news text Nachrichten Devisen und Rohstoffe wrapper classes box-wrap clearfix tabs all selected true title Alle api filter attribute categories id values 2118 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 6 archiveButton enabled true auto false classes button right icon-arrow-right text Zum Nachrichten-Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 2118 target self tabId commodity-currency-tab-all panelId commodity-currency-panel-all skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 2 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null currency title Devisen api filter attribute instruments assetClass id values 3 type include attribute categories id values 2118 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 6 archiveButton enabled true auto false classes button right icon-arrow-right text Zum Nachrichten-Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 2118 instruments assetClass id 3 target self tabId commodity-currency-tab-currency panelId commodity-currency-panel-c 07 1806 1805 1803 1804 1311 type include archiveButton enabled true classes button right mt20 link einsteiger-und-wissen text Zum Einsteiger- und Wissensbereich published work segment published work config headline text Das neueste Online-Magazin classes icon-newspaper single api limit 1 attributes id title autoTeaser teaser slug publication beemailId edition toc previewImages categories mailinglists author filter attribute categories id values 1267 1269 1268 1272 1271 1236 type include show published true previewImages count 2 archiveButton classes button right enabled true text Alle Online-Magazine link magazine partner marquee segment partner marquee next segment list view list highlight html twig config skipIfEmpty false headline text Das n u00e4chste Webinar classes icon-info single api attributes start end teaser description type typeName logoUrl price moderators filter attribute charging values free type include attribute tags id values 2143 type include limit 1 archiveButton enabled false gmtblog segment article list config headline text Der GodmodeTrader-Blog classes icon-news single hot enabled true count 1 image enabled true type cover width 298 height 100 api limit 1 attributes commentCount author autoTeaser teaser images teaser id images teaser source slug source externalUrl filter attribute categories id values 1808 type include archiveButton enabled true classes button right link godmode-trader-blog text Zum Blog chartgallery segment chartgallery view chartgallery html twig config single archiveButton enabled true auto true classes button right icon-arrow-right link chartgalerie text Alle Chartanalysen im u00dcberblick limit 3 api limit 10 sentifi segment sentifi window ENVIRONMENT prod if !window DYNAMIC i c window CONFIG only segmentad should be dispatched! for in c j if segments for in c if c i controller segmentad j c i window CONFIG document write else document write window BG window BG i18n de charts domain charting locale data charting domain charting lang de plural forms nplurals 2 plural n ! 1 Configuration not supported null Konfiguration nicht unterstützt year null Jahr Jahre month null Monat Monate week null Woche Wochen day null Tag Tage hour null Stunde Stunden minute null Minute Minuten X-Axis Labels null X-Achsen Beschriftung None null Keine Marks null Markierungen Standard null Standard Top Margin null Abstand oben Bottom Margin null Abstand unten Unmerge up null Nach oben herauslösen Unmerge down null Nach unten herauslösen Merge up null Nach oben zusammenführen Merge down null Nach unten zusammenführen Relocate null Verschieben Display Descriptions null Beschreibung anzeigen Relative Performance null Relative Wertentwicklung Left Y-Axis null Linke Y-Achse Right Y-Axis null Rechte Y-Achse Y-Axis null Y-Achse New hidden Y-Axis null Neue unsichtbare Y-Achse Select Y-Axis null Y-Achse wählen Visual Order null Darstellungsreihenfolge Send to Back null In den Hintergrund Bring to Front null In den Vordergrund Send Backward null Nach hinten schieben Bring Forward null Nach vorne holen Trend u0004Rising null Steigend Trend u0004Flat null Neutral Trend u0004Falling null Fallend Linda u0004Rising null Long Linda u0004Flat null Ausstieg Linda u0004Falling null Ausstieg Trend u0004Rising null Steigend Trend u0004Flat null Neutral Trend u0004Falling null Fallend Linda u0004Rising null Long Linda u0004Flat null Flat Linda u0004Falling null Flat span short u0004 year null dJ dJ span short u0004 month null dM dM span short u0004 week null dW dW span short u0004 day null dT dT span short u0004 hour null dS dS span short u0004 minute null dM dM IKH u0004Turning Line Periods null Drehende Linie Periode IKH u0004Standard Line Periods null Standard Linie Periode IKH u0004Displacement null Verschiebung IKH u0004Cloud null Wolke kumo IKH u0004Standard null Standard kijun IKH u0004Turning null Drehend tenkan IKH u0004Lead1 null Vorauseilend 1 IKH u0004Lead2 null Vorauseilend 2 IKH u0004Lagging null Verzögert chikou IKH u0004Leading Span 2 Periods null 2 Vorauseilende Periode Failed to load data null Daten konnten nicht geladen werden Arrow null Pfeil Narrow Arrow null Pfeil Schmal Displacement null Verschiebung Legend null Legende Legend color rising null Legendenfarbe Steigend Legend color falling null Legendenfarbe Fallend Free Positioning null Freie Platzierung Legend layout null Legendenanordnung Vertical null Vertikal Horizontal null Horizontal Calculate using null Berechnen mit Input null Quelle Input null Quelle Initial factor null Initialer Faktor Increment null Zuwachsrate Maximum factor null Maximaler Faktor Circles null Kreise Size null Größe Ranges null Bereiche Range null Bereich Range in null Bereich in True Range Target ATR null True Range Target ATR Price Range null Preisbereich Date Range null Zeitbereich Price 1 null Preis 1 Price 2 null Preis 2 Show half-way levels null Mittelwerte anzeigen Show historic values null Historische Werte anzeigen Visible null Anzeigen Active null Aktiv Price null Kursstellung Exchange null Handelsplatz Handelsplätze No data available null Keine Daten verfügbar No volume available null Kein Volumen verfügbar Not enough data available null Nicht genug Daten verfügbar Wrong chart type Point and Figure required null Falscher Charttyp Point and Figure wird benötigt Mainchart null Hauptchart Marker High null Marker Hoch Marker Low null Marker Tief Marker Close null Marker Aktuell Marker null Marker Volumechart null Volumenchart Indicatorchart null Indikatorchart Indicatorchart null Indikatorchart Logarithmic Scale null Logarithmische Skala Automatic Range null Automatischer Wertebereich Show Session Breaks null Tagesgrenzen anzeigen Session Breaks null Tagesgrenzen Show grid null Gitter anzeigen Show legend null Legende anzeigen Show values in legend null Wert in Legende anzeigen Period null Periode Factor null Faktor Calculation null Berechnung Open null Eröffnungskurse High null Hoch Low null Tief Close null Schlusskurse HighLow null Hoch und Tief Previous markers null Vortagesmarker Baseline null Nulllinie Upper signal line null Obere Signallinie Lower signal line null Untere Signallinie K period null K Periode period null Periode 2th period null 2 Periode R period null R Periode Fast period null 1 Periode Slow period null 2 Periode Signal line null Signallinie Signal period null Signal Periode Difference null Differenz Signal null Signal No data available benchmark instrument required null Keine Daten verfügbar Vergleichswert fehlt Periodsyear null HandelsperiodenJahr Miscellaneous null Sonstige Oscillators null Oszillatoren Trend following null Trendfolger Fill color null Füllfarbe Border color null Rahmenfarbe Band null Band Layout null Layout Plain null Einfarbig Bicolored null Zweifarbig Color incomplete null Farbe Aktuell Color rising null Farbe Steigend Color falling null Farbe Fallend Border color incomplete null Rahmenfarbe Aktuell Border color rising null Rahmenfarbe Steigend Border color falling null Rahmenfarbe Fallend Presentation null Darstellung Processing null Verarbeitung Body null Körper Border null Rahmen Histogram null Histogramm Toggle display mode null Ansicht wechsel Mountain null Mountain OHLC null OHLC Line null Linie Linien Linear null Linear Percentage null Prozentual Logarithmic null Logarithmisch Absolute null Absolut Mode null Modus Candle null Kerze Kerzen Candles null Kerzen Heikin Ashi null Heikin Ashi Point and Figure null Point and Figure Labels null Beschriftung Label null Beschriftung Shapes null Formen Settings null Einstellungen Color null Farbe Farben Averages null Durchschnitte Zones null Zonen Marker null Marker Width null Dicke Thin null Dünn Normal null Normal Large null Groß Very large null Sehr Groß Thick null Dick Thicker null Dicker Upper threshold null Obere Grenze Lower threshold null Untere Grenze Upper color null Obere Farbe Lower color null Untere Farbe Volume null Volumen Background null Hintergrund Border null Rahmen Andrews Pitchfork null Andrews Pitchfork Line style null Linienart Dotted null Gepunktet Dashed null Gestrichelt Line width null Liniendicke Trend null Trend Candlepattern null Kerzenmuster Trendpattern null Trendmuster Chartpattern null Chartmuster Strategypattern null Strategiemuster Quotespecific pattern null Kursspezifisches Muster Kursspezifische Muster Trend Channel null Trendkanal Trendkanäle Candlepatterns null Kerzenmuster Trendpatterns null Trendmuster Chartpatterns null Chartmuster Strategypatterns null Strategiemuster Quotespecific patterns null Kursspezifische Muster Trend Channels null Trendkanäle Pattern type null Mustertyp Focus on pattern null Muster fokussieren Pattern length null Länge des Musters Breakout direction null Ausbruchsrichtung Breakout time null Ausbruchszeitpunkt Yield expectations null Renditeerwartung Quote potential level 1 null Kursziel Level 1 Quote potential level 2 null Kursziel Level 2 Always show details null Details immer anzeigen Nearest resistance null Nächstgel Widerstand Nearest support null Nächstgel Unterstützung Important resistance null Wichtiger Widerstand Important support null Wichtige Unterstützung Curve null Bogen Fibo Fan null Fibo-Fächer Fibo Level null Fibo-Level Fibo Projection null Fibo-Projektion Value null Wert Show Change null Veränderung anzeigen Level null Level Level - Value null Level - Wert Text position null Textposition Left null Links Right null Rechts Center null Mitte Bottom left null Unten links Bottom right null Unten rechts Extend null Verlängern Left and Right null Links und Rechts Extend to the left null Links verlängern Extend to the right null Rechts verlängern Don t extend null Nicht verlängern Don t extend to the left null Links enden Don t extend to the right null Rechts enden Convert to Trend Channel null Zu Trendkanal konvertieren Line color null Linienfarbe Text color null Textfarbe Fibo Time Projection null Fibo-Zeitprojektion Only lines null Nur Linien Only markers null Nur Markers and lines null Marker und Linien Show markers null Marker anzeigen Show marker null Marker anzeigen Marker fill color null Marker Hintergrundfarbe Marker border color null Marker Rahmenfarbe Gann Fan null Gann Fächer Invert null Invertieren Horizontal Line null Horizontale Linie Text style null Schriftstil Text size null Schriftgrösse Text alignment null Ausrichtung Text anchor null Verankerung Line layout null Linienart Position of description null Position Beschreibung No line null Keine Linie Ray null Gerade Line null Linie Linien Bold null Fett Italic null Kursiv Bold Italic null Fett Kursiv Path null Pfad Fill null Füllen Show arrow null Pfeil anzeigen Show dots null Punkte anzeigen Circle null Kreis Ellipsis null Ellipse Rectangle null Rechteck Triangle null Dreieck Symbol null Symbol Text null Text Trend Line null Trendlinie PnF Trend Line null PnF Trendlinie PnF Vertical Target null PnF Vertikales Ziel PnF Horizontal Target null PnF Horizontales Ziel Show distance to price null Abstand zum Kurs anzeigen Vertical Line null Vertikale Linie Fibonacci Fan null Fibonacci Fächer Fibonacci null Fibonacci Level null Fibonacci Level Fibonacci Projection null Fibonacci Projektion OHLC Projection null OHLC Projektion Projection null Projektion Reference null Referenz Add point null Punkt hinzufügen Remove last point null Letzten Punkt entfernen Description null Beschreibung Intraday null Intraday Days null Tage Custom span null Anderer Zeitraum span u0004Manual null Manuell Span null Zeit Crosshair null Fadenkreuz Tapeline null Maßband Apply null Übernehmen Extras null Extras Magnet null Magnet Indicators null Indikatoren Tools null Werkzeuge Chart null Chart Span - Interval - Type - Settings null Zeitraum - Intervall - Charttyp - Einstellungen Sidebar null Bar Actions null Aktionen Reset chart null Chart zurücksetzen Save null Speichern Save as null Speichern als Load null Laden Create Subfolder null Neuer Unterordner New folder null Neuer Ordner Save defaults null Standard speichern Clear defaults null Standard löschen Save image null Bild speichern Print null Drucken Download null Herunterladen Save Image null Bild speichern New window null Neues Fenster Help null Hilfe Quotelist null Kursliste Kurslisten Portfolio null Portfolio My Charts null Meine Charts Chartgallery null Chartgalerie Open Portfolio null Zum Portfolio WatchlistPortfolio null WatchlistePortfolio Advertisement null Anzeige Type null Typ Direction null Richtung WKN null WKN EXCH null HP CUR null ISIN Underlying null Basiswert Leverage null Hebel Keyword null Suchbegriff TimeSeries null Zeitreihe Zeitreihen Instrument null Wert Werte Object null Objekt Objekte Current price null Aktueller Wert Relative change null Relative Veränderung Absolute change null Absolute Veränderung Sign in to store configurations null Melden Sie sich an um Charts zu speichern Name null Name Tags null Tags Public null Öffentlich Link null Link Image URL null Bild URL Choose folder null Ordner wählen Chart null Chart Charts Folder null Ordner Use text to simplify searching E g Gold DAX Date null Tags erleichtern das Suchen Bsp Gold Jahr US Store position on X and Y achses null Position auf X- und Y-Achse speichern Please enter a start date for your chart null Bitte geben Sie ein Startdatum für Ihren Chart an Startdate null Startdatum Please select the desired size and format null Bitte geben Sie das gewünschte Format und die Größe an Please enter a name null Bitte geben Sie einen Namen ein Filename null Dateiname Value on price scale null Wert auf Preisachse Format null Format Image width null Bildbreite Image height null Bildhöhe Zoom null Zoom Undo null Undo Watchlist null Watchlist Watchlisten Depot null Depot Depots Template null Vorlage Vorlagen New template null Neue Vorlage Unnamed null Unbenannt Parameters null Parameter Data null Daten Configure null Konfigurieren No settings available null Keine Einstellungen verfügbar OK null OK Cancel null Abbrechen Yes null Ja No null Nein Copy null Kopieren Delete null Löschen Rename null Umbenennen Load null Laden Save null Speichern Load chart null Chart laden Save chart null Chart speichern Load as template null Als Vorlage laden Show details null Details anzeigen Root directory null Hauptverzeichnis Delete chart? null Chart löschen? Delete folder? null Ordner löschen? Failed to load chart null Chart konnte nicht geladen werden Replace instrument null Wert austauschen Add benchmark null Benchmark hinzufügen Do you really want to delete this folder and all charts contained within?Links to charts shared with other users will continue to be valid even after deletion null Wollen Sie diesen Ordner und alle darin enthaltenen Charts wirklich löschen?Links zu Charts die mit anderen Benutzern geteilt wurden bleiben weiterhin gültig Do you really want to delete this chart?Links to charts shared with other users will continue to be valid even after deletion null Wollen Sie diesen Chart wirklich löschen?Links zu diesem Chart die mit anderen Benutzern geteilt wurden bleiben weiterhin gültig Limit reached null Limit erreicht You have reached the maximum number of configurations Before you can store another configuration you will first have to delete an existing one null Sie haben die maximale Anzahl an Konfigurationen erreicht Um einen neuen Chart abzuspeichern müssen Sie zuerst einen vorhandenen entfernen Correlation null Korrelation document t addEventListener a t attachEvent r removeEventListener detachEvent e t ? DOMContentLoaded onreadystatechange a call e function h r call e h false require gmtdispatcher gmtinit function window CONFIG ll loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 2219 page 1 pageSize 4 pages 555 isSkipped false news partner controller segment article list segment article list config headline level 3 classes icon-news text Nachrichten unserer Partner wrapper classes box-wrap clearfix tabs null single archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null api limit 4 attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored filter attribute categories id values 2138 type include attribute typeId values 20 type exclude resource article action list skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 67 page 1 pageSize 4 pages 17 isSkipped false latest newcomer entities controller segment article list segment article list config headline level 3 classes icon-news text Neu im Einsteigerbereich wrapper classes box-wrap green clearfix tabs null single boxColor green show title true author true comment true teaser true teaserOnImage false date true textOnImage false horizontal enabled true columns 4 hot enabled true count 3 backgroundColor null classes null appendAuthor enabled false image enabled true type cover width 298 height 100 api limit 3 attributes commentCount author autoTeaser teaser images teaser id images teaser source slug source externalUrl isSponsored filter attribute categories id values 1807 1806 1805 1803 1804 1311 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled true auto false classes button right mt20 text Zum Einsteiger- und Wissensbereich textDefault false link einsteiger-und-wissen target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 448 page 1 pageSize 3 pages 150 isSkipped false published work controller segment published work segment published work config headline level 3 classes icon-newspaper text Das neueste Online-Magazin defaults api resource article action list item beemailId null external false title null description null listClasses boxColor white seaCampaign enabled false events readButtonClick null triggerClick null subscribeError null subscribeComplete null lightbox enabled true preview enabled false source null title null classes right ml15 headerImage enabled false source null previewImages enabled true type toc classes images path null count 5 archiveButton enabled false text Zum Archiv link classes button right show toc true published false date true footer false publication edition true published true toc true mailinglistRegistrationMode modal mailinglistId null mailinglist loadingMask true broadcast true confirm false button read html Kostenlos downloaden class button left w49 subscribe html Jetzt kostenlos abonnieren class button button-primary right w49 subscribed html Bereits abonniert class message success subscribed right w49 modal title Jetzt anmelden yepNope true text null boxAutomatic true confirm true additional privacy true boxes emailAddress false register false login false closable true message successful Vielen Dank u00fcr Ihre Anmeldung successfulNotAuthenticated Vielen Dank u00fcr Ihre Anmeldung! Sie erhalten in k u00fcrze eine E-Mail mit einem Best u00e4tigungslink failure Es ist ein Fehler aufgetreten - bitte kontaktieren Sie den Administrator subscribed Sie sind u00fcr diesen Newsletter bereits angemeldet invalidEmailAddress Bitte geben Sie eine korrekte E-Mail Addresse an nameMissing Bitte geben Sie Ihren Vor- und Nachnamen an publicationId null wrapper classes box-wrap clearfix single api limit 1 attributes id title autoTeaser teaser slug publication beemailId edition toc previewImages categories mailinglists author filter attribute categories id values 1267 1269 1268 1272 1271 1236 type include resource article action list show toc true published true date true footer false publication edition true published true toc true previewImages enabled true type toc classes images path null count 2 archiveButton enabled true text Alle Online-Magazine link magazine classes button right beemailId null external false title null description null listClasses boxColor white seaCampaign enabled false events readButtonClick null triggerClick null subscribeError null subscribeComplete null lightbox enabled true preview enabled false source null title null classes right ml15 headerImage enabled false source null mailinglistRegistrationMode modal mailinglistId null mailinglist loadingMask true broadcast true confirm false button read html Kostenlos downloaden class button left w49 subscribe html Jetzt kostenlos abonnieren class button button-primary right w49 subscribed html Bereits abonniert class message success subscribed right w49 modal title Jetzt anmelden yepNope true text null boxAutomatic true confirm true additional privacy true boxes emailAddress false register false login false closable true message successful Vielen Dank u00fcr Ihre Anmeldung successfulNotAuthenticated Vielen Dank u00fcr Ihre Anmeldung! Sie erhalten in k u00fcrze eine E-Mail mit einem Best u00e4tigungslink failure Es ist ein Fehler aufgetreten - bitte kontaktieren Sie den Administrator subscribed Sie sind u00fcr diesen Newsletter bereits angemeldet invalidEmailAddress Bitte geben Sie eine korrekte E-Mail Addresse an nameMissing Bitte geben Sie Ihren Vor- und Nachnamen an publicationId null cursor totalCount 416 page 1 pageSize 1 pages 416 isSkipped false partner marquee controller segment partner marquee segment partner marquee config title partnermarquee isSkipped false next controller null segment list config headline level 3 text Das n u00e4chste Webinar classes icon-info wrapper classes box-wrap clearfix defaults item boxColor white search null archiveButton enabled true text Mehr link webinare-und-seminare classes button right icon-arrow-right api resource action list order start asc limit 5 attributes logoUrl registrationUrl skipIfEmpty false single api attributes start end teaser description type typeName logoUrl price moderators filter attribute charging values free type include attribute tags id values 2143 type include attribute start values 2016-09-01T21 30 20 02 00 type greater and equal than limit 1 resource action list order start asc archiveButton enabled false text Mehr link webinare-und-seminare classes button right icon-arrow-right boxColor white search null cursor totalCount null page null pageSize 1 pages null isSkipped false gmtblog controller segment article list segment article list config headline level 3 classes icon-news text Der GodmodeTrader-Blog wrapper classes box-wrap clearfix tabs null single hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type cover width 298 height 100 api limit 1 attributes commentCount author autoTeaser teaser images teaser id images teaser source slug source externalUrl isSponsored filter attribute categories id values 1808 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled true auto false classes button right text Zum Blog textDefault false link godmode-trader-blog target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 49 page 1 pageSize 1 pages 49 isSkipped false chartgallery controller segment chartgallery config headline text Chartgalerie single limit 3 archiveButton enabled true auto true classes button right icon-arrow-right link chartgalerie text Alle Chartanalysen im u00dcberblick api limit 10 resource article action list page 1 attributes date slug detailcharts autoTeaser filter attribute typeId values 11 type include attribute isPremium values type include params portal gmt defaults api resource article action list limit 30 page 1 attributes date slug detailcharts autoTeaser filter attribute typeId values 11 type include attribute isPremium values type include params portal gmt cursor totalCount 115241 page 1 pageSize 10 pages 11525 isSkipped false sentifi controller segment sentifi config headline level 3 classes icon-news text Die meist-diskutierten Basiswerte im Web url sentifi com engine js?key c53eec3958c7242 10808697 isSkipped false no script controller null segment hotline config title null titleClass phone headline Aktivieren Sie JavaScript um sich anzumelden! body Sehr geehrter User dieser Inhalt kann leider nicht korrekt dargestellt werden Daf u00fcr kann es zwei M u00f6glichkeiten geben a Sie verwenden einen alten Browser zum Beispiel Internet Explorer 8 Bitte aktualisieren Sie Ihren Browser um unsere Webseite mit allen Funktionen nutzen zu k u00f6nnen b Sie haben JavaScript deaktiviert Bitte aktivieren Sie JavaScript in Ihrem Browser um auf unserer Seite ohne Einschr u00e4nkungen zu surfen So aktivieren Sie JavaScript Mozilla Firefox Internet Explorer Google Chrome Safari Ihr Team von GodmodeTrader de n color yellow image null isSkipped false navBar controller segment navigation config file false activeClass act adjustWidth false useQueryString true configNode null children false searchable true classes active null marketoverview enabled true push true map 133942 name ES50 133965 name DJIA 133978 name u00d6l 133955 name NDQ api resource instrument action list attributes id name assetClass id slug fullName refQuotation quote precision filter attribute listComponentOf id values 625 type include tag main sticky false isSkipped false metaNavBar controller segment navigation config file false activeClass act adjustWidth false useQueryString true configNode null children false searchable false classes active null marketoverview enabled false push true map 133942 name ES50 133965 name DJIA 133978 name u00d6l 133955 name NDQ api resource instrument action list attributes id name assetClass id slug fullName refQuotation quote precision filter attribute listComponentOf id values 625 type include tag headline sticky false mailinglistId 113 mailinglistModalText Mit dem GodmodeNewsletter erhalten Sie regelm u00e4 u00dfig n u00fctzliche Informationen zu den verschiedenen Leistungen und Angeboten von GodmodeTrader nelId news-de-europa-panel-ach skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null single null skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null api resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl limit 10 isSkipped false news usa controller segment article list segment article list config headline level 3 classes icon-region usa text US-M u00e4rkte wrapper classes box-wrap clearfix tabs null single hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null api attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored filter attribute categories id values 65 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled true auto true classes button right icon-arrow-right text Zum US-M u00e4rkte Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 65 target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 94652 page 1 pageSize 10 pages 9466 isSkipped false news forex commodities controller segment article list segment article list config headline level 3 classes icon-region currency text Devisen und Rohstoffe wrapper classes box-wrap clearfix tabs analyses selected true title Chartanalysen und Nachrichten api filter attribute categories id values 1774 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 7 archiveButton enabled true auto true classes button right icon-arrow-right text Zum Chartanalysen und Nachrichten Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 1774 target self tabId news-forex-commodities-tab-analyses panelId news-forex-commodities-panel-analyses skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null noblemetals title Edelmetalle api filter attribute categories id values 1774 type include attribute instruments id values 133979 133984 133983 133985 1062279 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 7 archiveButton enabled true auto true classes button right icon-arrow-right text Zum Edelmetalle Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 1774 instruments id 133979 133984 133983 133985 1062279 target self tabId news-forex-commodities-tab-noblemetals panelId news-forex-commodities-panel-noblemetals skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null currencies title Devisen api filter attribute categories id values 1774 type include attribute instruments assetClass id values 3 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 7 archiveButton enabled true auto true classes button right icon-arrow-right text Zum Devisen Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 1774 instruments assetClass id 3 target self tabId news-forex-commodities-tab-currencies panelId news-forex-commodities-panel-currencies skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null single null skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null api resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl limit 7 isSkipped false fundamental comments controller segment article list segment article list config headline level 3 classes icon-chart-bar text Kommentare zu Wirtschaft B u00f6rse und Politik wrapper classes box-wrap blue clearfix tabs null single hot enabled true count 5 backgroundColor null classes null appendAuthor enabled false image enabled true type author width null height null api limit 7 attributes body author slug commentCount teaser source externalUrl isSponsored filter attribute categories id values 827 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled true auto false classes button right icon-arrow-right text Mehr aus Wirtschaft B u00f6rse und Politik textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 827 target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cursor totalCount 8299 page 1 pageSize 7 pages 1186 isSkipped false expert comments controller segment article list segment article list config headline level 3 classes icon-news text Kommentare zu Charttechnik Trading und Investments wrapper classes box-wrap green clearfix tabs null single hot enabled true count 5 backgroundColor null classes null appendAuthor enabled false image enabled true type author width null height null api limit 7 attributes body author slug commentCount teaser source externalUrl isSponsored filter attribute categories id values 1258 type include attribute typeId values 20 type exclude resource article action list archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes author autoTeaser slug commentCount teaser cu IKE Inc 58 370 730 1 27 21 15 12 The Procter und Gamble Co 88 065 755 86 21 15 16 Verizon Communications Inc 52 625 295 56 21 15 16 The Goldman Sachs Group Inc 167 880 -1 580 -0 93 21 15 15 Caterpillar Inc 81 150 -0 820 -1 00 21 15 14 Chevron Corp 99 550 -1 030 -1 02 21 15 16 American Express Co 64 740 -0 840 -1 28 21 15 16 Zur Kursliste Name Kurs - abs - Zeit Charter Communications Inc 271 425 14 215 5 53 21 15 11 Norwegian Cruise Line Holdings 33 077 1 137 3 56 14 42 48 Expedia Inc 112 630 3 510 3 22 21 15 15 Ctrip com International Ltd 48 835 1 485 3 14 21 15 11 Gilead Sciences Inc 77 010 -1 370 -1 75 21 15 15 Mondelez International Inc 43 900 -1 120 -2 49 21 15 17 Costco Wholesale Corp 155 680 -6 410 -3 95 21 15 15 Tesla Motors Inc 201 070 -10 940 -5 16 21 15 14 Zur Kursliste GodmodeTrader Newsticker Nachrichten User-Kommentare Letzte Aktualisierung unbekannt Laden In neuem Fenster öffnen Bitte aktivieren Sie JavaScript in Ihrem Browser um dieses Feature im vollen Funktionsumfang nutzen zu können Wirtschaftsdaten-Kalender Land Datum Termin 01 50 JP Geldbasis August yy 02 09 16 JP Verbrauchervertrauen August 02 09 16 SP Arbeitslosenzahl August mm in Tsd 02 09 16 SP Arbeitslosenquote Q2 02 09 16 GB Einkaufsmanagerindex Bausektor August Wirtschaftsdaten-Kalender Kommentare zu Charttechnik Trading und Investments Wird das geschaufelte Loch der Zentralbanken zu groß um noch hinauszusteigen? 1 13 29 - Nach dem Treffen der Zentralbänker in Jackson Hole scheint sich das mit expanisver Geldpolitik geschaufelte Loch weiter zu vergrößern Die Währungshüter scheinen dabei keinen konkreten Ausweg zu ha von M Suckart mehr EURUSD Analyse Das Zögern der Fed wird zur Regel 10 02 - Die Aufschiebung der Fed-Entscheidungen schlägt sich auf den Marktverlauf nieder EURUSD im Fokus Rückblick Aussichten und Euro-Chart von Chrzanowski mehr DAX - Die bullische Ausgangslage bleibt! 09 56 - Am 30 August nahmen wir den DAX mit der Möglichkeit eines Ausbruchs über 10 650 Punkte ins Visier und letztlich klappte es nicht wirklich Bullen am Ende? von C Kämmerer - JFD Brokers mehr DAX Korrekturtrend überwunden 08 47 - Der DAX konnte gestern nicht an die vorgestern gerissene Aufwärtskurslücke 10 567 zu 10 588 Punkte anknüpfen was sich idealtypisch an dem gestern ausgeprägten EURinside dayEUR festmachen lässt Die von Scherer mehr Commerzbank Aktie bricht nach oben aus 08 35 - Bereits in der letzten Woche hatten wir die Aktie der Commerzbank etwas genauer betrachtet und erkannt dass wir nahe einer möglichen Trendwende sein könnten Erkennbar war dies durch die jüngsten von A Mautz mehr 08 30 - DZ BANK EUR DAX Weiteres Aufwärtspotenzial vorhanden von DZ Bank 31 08 2016 - Albtraum der Notenbanken wird wahr von JFD Brokers Charttechnische Kommentare DAX Trading Webinaraufzeichnung Erklärung von GRÄFE-XXL vom 1 9 2016 1 15 40 - Das Video zum schriftlichen DAX Tagesausblick Weiterführender detaillierter unterhaltsam! Visualisierte DAX Tagesprognose! Viel Erfolg! von R Gräfe mehr DEUTSCHE BANK vs COMMERZBANK 6 10 10 - Na wenigstens in einem Sektor steppt der Bulle Die Banken führen auch heute die Gewinnerlisten an Wer aber hat intern die Nase vorn? von R Berteit mehr Charts und Co DAX EURUSD US Finanztitel 31 08 2016 - Infolge des Notenbanker-Events am vergangenen Freitag haben sich abseits von den Indizes klare Tendenzen ergeben Die Edelmetalle und EURUSD fallen Finanztitel legen zu Über dieses Thema und natürlich auch über den DAX sprach ich mit Thomas Zuleck von der Börse Stuttgart von B Galuschka mehr Die erste Million ist die schwerste! Aber wie schaffen? 3 31 08 2016 - Das Vermitteln von Trading-know ow ist einer der Gründe warum ich meinen Guidants-Desktop betreue von C Struy mehr MDAX - Endlich ist es soweit! 6 31 08 2016 - Fazit Oberhalb der 18853 00er Marke liegt ein Kursziel bei 30111 00 Punkte Der MDAX verfolgt ungebremst das favorisierte Szenario von A Tiedje mehr 31 08 2016 - DAX-Investoren weiterhin nur Zuschauer? von R Berteit 2 30 08 2016 - Strehks Tradingideen ThyssenKrupp Yahoo CA von M Strehk Mehr aus Charttechnik Trading und Investments Die neuesten Videos von GodmodeTrader Der Tag an den Märkten - Ausblick auf die Non Farm Payrolls 18 00 - von B Galuschka mehr US Aktien im Fokus FISERV WYNN RESORTS 17 00 - US-Aktien im Fokus mehr EVONIK - So sehen frischgebackene Bullen aus 16 33 - Wunschanalyse Aktien mehr Zum Archiv Chartanalysen Asien und Emerging Markets USDJPY - Die Zinserhöhungsphantasie ist zurück 30 08 2016 - Die Kommentare der Fed-Chefin in Wyoming vom vergangenen Freitag haben dem Währungspaar wieder Rückenwind verleitet von H Philippson mehr 30 08 2016 - China und USA bald auf Konfrontationskurs? von C Schmale 3 22 08 2016 - Emerging Markets Bonds - Langfristiges Kaufsignal möglich von H Weygand 1 17 08 2016 - BOVESPA Brasilien Die Rally läuft und sie hat noch Potential von H Weygand 16 08 2016 - HANG SENG Projektionsziel in Reichweite und jetzt? von H Weygand 11 08 2016 - SOFTBANK - Kennen Sie diese Aktie noch? von H Weygand Zum Chartanalysen Asien und Emerging Markets Archiv Nachrichten Devisen und Rohstoffe Alle Devisen Rohstoffe EURJPY Japanischer Einkaufsmanagerindex verliert weiter 15 37 - Der Einkaufsmanagerindex des verarbeitenden Gewerbes ist in der endgültigen Fassung im August auf 49 5 Punkte gefallen von H Rehbein mehr EURGBP Industrie-Einkaufsmanager in Großbritannien zuversichtlicher 15 35 - Der Einkaufsmanagerindex für das Verarbeitende Gewerbe in Großbritannien hat sich im August überraschend auf 53 3 Punkte erhöht von H Rehbein mehr 15 33 - EURUSD US-Erstanträge legen leicht zu von H Rehbein 12 25 - USDNOK Einkaufsmanagerindex enttäuscht von T Hansmann 11 53 - USDCHF Einzelhandelsumsätze erneut rückläufig von T Hansmann 10 23 - Getreide Zumeist reichliches Angebot von T Hansmann Zum Nachrichten-Archiv EURJPY Japanischer Einkaufsmanagerindex verliert weiter 15 37 - Der Einkaufsmanagerindex des verarbeitenden Gewerbes ist in der endgültigen Fassung im August auf 49 5 Punkte gefallen von H Rehbein mehr EURGBP Industrie-Einkaufsmanager in Großbritannien zuversichtlicher 15 35 - Der Einkaufsmanagerindex für das Verarbeitende Gewerbe in Großbritannien hat sich im August überraschend auf 53 3 Punkte erhöht von H Rehbein mehr 15 33 - EURUSD US-Erstanträge legen leicht zu von H Rehbein 12 25 - USDNOK Einkaufsmanagerindex enttäuscht von T Hansmann 11 53 - USDCHF Einzelhandelsumsätze erneut rückläufig von T Hansmann 31 08 2016 - EURUSD ADP meldet 177 000 neue Stellen von T Hansmann Zum Nachrichten-Archiv Getreide Zumeist reichliches Angebot 10 23 - Bei Weizen dürfte die bereits sehr hohe Stocks-to-Use-Ratio Verhältnis von Lagerbeständen und Verbrauch Helaba-Analyst Heinrich Peters zufolge noch weiter ansteigen von T Hansmann mehr Ölpreise weiter nahe Vortagstiefs 10 16 - Laut wöchentlichem US-Ölmarktbericht des US-Energieministeriums sind die US-Rohölbestände in der Woche bis zum 26 August 2016 um 2 28 Millionen Barrel auf 525 9 Millionen Barrel gestiegen von T Hansmann mehr 10 05 - Nickel Ausweitung des Defizits von T Hansmann 31 08 2016 - Gibt es ein Zusammenspiel der Kohle- und Ölmärkte? von B Lammert 31 08 2016 - Gold Erster Monatsverlust seit Mai von T Hansmann 2 31 08 2016 - Ölpreise sinken vor US-Lagerdaten weiter von T Hansmann Zum Nachrichten-Archiv Nachrichten weltweit Alle Asien und Emerging Markets China Dezente Belebung bei den Industrieunternehmen 16 25 - Der Einkaufsmanagerindex des chinesischen Handelsverbands CFLP und des Nationalen Statistikamts zeigt im August eine erfreuliche Entwicklung Insbesondere überrascht dass die Unternehmen sich vor Neuaufträgen kaum retten können von B Lammert mehr Brasilien Temer beerbt Rousseff - Kritiker befürchten Wiedergeburt des Neoliberalismus 16 23 - Der neue Präsident Brasiliens Temer ist zwar wenig beliebt Mit einem wirtschaftsliberalen Konzept will er aber Brasilien aus der Krise führen von B Lammert mehr 31 08 2016 - Japan rüstet sich für Inselstreit mit China von B Lammert 31 08 2016 - Finaler Akt in Brasilien von B Lammert 30 08 2016 - Mexikanische Notenbank sorgt sich um die Schwäche des Pesos von B Lammert 30 08 2016 - Japan gilt in Sachen Arbeitsmarkt als vorbildlich von B Lammert Zum Nachrichten-Archiv Japan rüstet sich für Inselstreit mit China 31 08 2016 - Japan will seine Verteidigungsausgaben auf Rekordniveau erhöhen Begründet wird dies mit dem Inselstreit mit China im Ostchinesischen Meer von B Lammert mehr Japan gilt in Sachen Arbeitsmarkt als vorbildlich 30 08 2016 - Lichtblick In Japan hat sich der Arbeitsmarkt zuletzt stark entwickelt Die Arbeitslosenquote ist auf den niedrigsten Stand seit 20 Jahren zurückgegangen von B Lammert mehr 29 08 2016 - Japan und die gewünschte Inflation Kampf gegen Windmühlen! von B Lammert 18 08 2016 - Der starke Yen verhagelt Japans Exporteuren das Geschäft von B Lammert 16 08 2016 - Australische Notenbank hält sich alle Türen offen von B Lammert 21 07 2016 - Bank of Japan sieht keine Notwendigkeit für Helikoptergeld von B Lammert Zum Nachrichten-Archiv Analysteneinschätzungen zu Aktien und Unternehmen Alle Europa Nordamerika 16 27 - Apple Milliardenschwere Steuernachzahlung aus der Portokasse von B Lammert 16 26 - Deutsche Bank Fusion mit Commerzbank wenig wahrscheinlich von B Lammert 31 08 2016 - Apple Steuerzahlung ohne weiteres verkraftbar - Imageschaden droht von B Lammert 31 08 2016 - E ON Bundesregierung offenbar zur vertraglichen Regelung bereit von B Lammert 30 08 2016 - RWE Kommt die Verwässerung durch die Hintertür ? von B Lammert 30 08 2016 - Stada Nun dürfte es wieder ruhiger zugehen von B Lammert 30 08 2016 - VTG Die Bäume für den Waggonvermieter wachsen nicht in den Himmel von B Lammert 29 08 2016 - Südzucker Süße Aussichten von B Lammert Alle Analysteneinschätzungen 16 26 - Deutsche Bank Fusion mit Commerzbank wenig wahrscheinlich von B Lammert 31 08 2016 - E ON Bundesregierung offenbar zur vertraglichen Regelung bereit von B Lammert 30 08 2016 - RWE Kommt die Verwässerung durch die Hintertür ? von B Lammert 30 08 2016 - Stada Nun dürfte es wieder ruhiger zugehen von B Lammert 30 08 2016 - VTG Die Bäume für den Waggonvermieter wachsen nicht in den Himmel von B Lammert 29 08 2016 - Südzucker Süße Aussichten von B Lammert 29 08 2016 - Stada Zeichen stehen auf Neuanfang von B Lammert 29 08 2016 - Kuka Eingeschränkte Liquidität der Aktie - Stärkere Kursschwankungen möglich von B Lammert Alle Analysteneinschätzungen Europa 16 27 - Apple Milliardenschwere Steuernachzahlung aus der Portokasse von B Lammert 31 08 2016 - Apple Steuerzahlung ohne weiteres verkraftbar - Imageschaden droht von B Lammert 23 08 2016 - Pfizer bleibt auf der Liste der am meisten bevorzugten Gesundheitstitel von B Lammert 22 08 2016 - Wal-Mart-Stores Wenig Spielraum für einen deutlichen Kursanstieg von B Lammert 18 08 2016 - Cisco Opfer des Wandels in der Branche von B Lammert 16 08 2016 - McDonaldEUR Operative Herausforderungen im Aktienkurs nicht ausreichend abgebildet von B Lammert 16 08 2016 - Linde Unsicherheiten im Zusammenhang mit Praxair-Fusion im Kurs nicht reflektiert von B Lammert 11 08 2016 - Procter und Gamble Nur begrenztes Kurspotenzial von B Lammert Alle Analysteneinschätzungen Nordamerika Zertifikate- Fonds- und ETF-News Indien Rasant steigender Binnenkonsum 12 42 - Die explosiv steigenden Wachstumsraten Indiens spiegeln sich Danske-Fondsmanager Antti Raappana noch nicht gleichermaßen an der indischen Börse wider von T Hansmann mehr 10 41 - Deutsche Konjunktur trotz des Brexit-Votums weiter aufwärtsgerichtet von T Hansmann 08 41 - Großbritannien Raueres Klima nach Brexit-Votum hinterlässt Spuren von T Hansmann 08 00 - Dividenden pünktlich wie die Schweizer Bahn von M Jordan Zum Zertifikate- Fonds- und ETF-News Archiv Nachrichten unserer Partner easyfolio gewinnt durch Hauck und Aufhäuser an Dynamik und steigert Assets under Management deutlich 15 33 - Frankfurt ots - - Assets under Management auf über 20 Mio Euro angestiegen - Bestnote Sehr gut im Vergleichstest der Euro am Sonntag - Erweiterung des Produktportfolios durch weitere Anlagem von Presseportal News mehr 13 24 - EANS-Adhoc Petro Welt Technologies AG Acquires Fracturing Company in Kazakhstan - Trican Well Service Kazakhstan Trican Ltd purchased from the Canadian firm Trican Well Service - Expansion of market outreach to consolidate market position in the CIS von Presseportal News 13 24 - EANS-Adhoc Petro Welt Technologies AG erwirbt Fracturing-Unternehmen in Kasachstan - Trican Well Service Kazakhstan Ltd Trican wird aus dem Besitz der kanadischen Trican Well Service übernommen - Ausweitung des Marktgebietes zur Festigung der Marktpo von Presseportal News 12 06 - Die Reimanns sind die reichsten Deutschen von Presseportal News Das neueste Online-Magazin Forex- und CFD Report - Das Ende der Geldpolitik Ausgabe 172016 veröffentlicht am 31 08 2016 Chartanalysen EURCHF GBPJPY USDJPY - Advertorial From Zero to hero - Wissen Elliott Wellen mit Tiedje - Das Ende der Geldpolitik - Wann kommt der Crack Up Boom? Aus dem Inhalt Chartanalysen EURCHF GBPJPY USDJPY Advertorial From Zero to Hero Wissen Elliott Wellen mit Tiedje Aktuelle Termine Wann kommt der Crack Up Boom? Kostenlos downloaden Jetzt kostenlos abonnieren Aktivieren Sie JavaScript oder installieren Sie einen aktuellen Browser um diesen Newsletter abonnieren zu können Alle Online-Magazine Anzeige medium-rectangle ID 2536323 378px 300px Matched Route - Route Targeting UNKNOWN window adspace medium-rectangle id 2536323 Die meist-diskutierten Basiswerte im Web Einen Moment bitte Das nächste Webinar Guten Morgen DAX-Index! moderiert von Dirk Friczewsky 02 09 2016 08 30 - 09 00 Uhr Webinar - veranstaltet von Admiral Markets Bei diesem Webinar steht der deutsche Leitindex DAX des Deutschen liebstes Kinde voll im Fokus! Jeden Montag Mittwoch und Freitag jeweils um 8 30 Uhr bespricht Moderator und Day-Trader Dirk Fr Kostenlos Jetzt anmelden Der GodmodeTrader-Blog Update der Guidants App für iOS 13 07 2016 - Mit der aktuellen Version 2 7 1 stellt die Guidants App für iPhone und iPad wieder einige neue Funktionen bereit Die Bedienung ist nun noch einfacher und intuitiver die Lesbarkeit verbessert und die Anzahl der Kurse in der Kompaktansicht erweitert von GodmodeTrader-Team mehr Zum Blog Chartgalerie CH ROBINSON - Logistiker startet 20 31 Uhr - Chart laden HALLIBURTON - Großes Top und Tschüss 20 02 Uhr - Chart laden Das große Comeback der US-Versicherer? 19 33 Uhr - Chart laden Alle Chartanalysen im Überblick Neu im Einsteigerbereich Bild Erni Fotolia com Meistern Sie den DAX 2 - Saisonal wird nochmals kritisch! 30 08 2016 - Die Saisonal größte Hürde des Jahres haben wir perfekt gemeistert aber auch im September wird es aus zyklischer Sicht im Deutschen Aktienindex noch einmal spannend von R Berteit mehr Bild BörseGo AG Meistern Sie den DAX 1 - Was ist wahrscheinlich? 29 08 2016 - Dieser Artikel soll den Startschuss für ein kleine DAX-Serie bilden in der wir uns diesen statistisch und tradingtechnisch ein wenig genauer ansehen von R Berteit mehr Bild Warakorn Fotolia com Impulsives DAX-Trading mit Hilfe der Elliott-Wellen-Theorie 1 29 08 2016 - Mit aktivem Elliott-Wellen-Trading lässt sich überproportional an Kursbewegungen profitieren Man muss aber die Regeln die Ralph Nelson Elliott aufgestellt hat genau kennen und befolgen von A Tiedje mehr Zum Einsteiger- und Wissensbereich Über GodmodeTrader Auf den Seiten von GodmodeTrader www godmode-trader de finden Sie kostenlose tagesaktuelle Chartanalysen Prognosen und Aktienanalysen Börsennews und Echtzeit-Nachrichten Echtzeit-Kurse Trading-Services Angebote z um Thema EURBörse für EinsteigerEUR und vieles mehr GodmodeTrader ist das reichweitenstärkste Internetportal für Börsenhandel Trading technische Analyse und Anlagestrategien im deutschsprachigen Raum Täglich werden hier umfangreiche Chartanalysen von Profi-Tradern Trading-Tipps sowie Hintergrundwissen zu den Themen Börse Finanzmärkte Trading Investieren und Anlegen veröffentlicht! Zu den Highlights auf den Seiten von GodmodeTrader gehört der tägliche DAX-Tagesausblick von Rocco Gräfe der konkrete Marken für das DAX-Trading nennt und der zur Pflichtlektüre für zahlreiche Daytrader und Anleger gehört Neben dem umfangreichen Gratis-Angebot bietet GodmodeTrader auch kostenpflichtige Analyse- und Trading-Services die von professionellen Tradern und Tradingcoaches betreut werden Hier können Sie die einzelnen Handelsentscheidungen der Trader live verfolgen selbst nachhandeln und sich mit unseren Profis austauschen! Zudem bietet GodmodeTrader ein umfassendes Ausbildungs- und Webinarangebot für jeden Anlegertyp vom Börsenneuling bis zum erfahrenen Daytrader Trading bezeichnet im Gegensatz zum Investieren den eher kurzfristig orientierten Handel von Wertpapieren und anderen Finanzprodukten Anders als ein klassischer Anleger versucht der Trader von Kursschwankungen in einem kurzfristigen Zeithorizont zu profitieren Viele Trader stützen sich bei ihren Anlageentscheidungen und Aktienempfehlungen auf die Technische Analyse Im Gegensatz zur Fundamentalanalyse die ihre Prognosen auf gesamtwirtschaftliche und unternehmerische Daten stützt zieht die Chartanalyse Kurs- und Umsatzverläufe der Aktien zu Rate Im Rahmen der Chartanalyse wird der historische Kursverlauf eines Index einer Aktie oder eines anderen Finanzinstruments grafisch dargestellt und ausgewertet Die vielfältigen Methoden der Chartanalyse liefern dabei signifikante Kauf- und Verkaufssignale Prognosen über den weiteren Kursverlauf und Kursziele Chartanalyse verbessert damit entscheidend das Timing und die Profitabilität von Anlageentscheidungen Kurse und Charts Indizes Devisen-Kurse Rohstoff-Kurse Sektoren Anleihen Realtime Kurse Ressorts Rohstoffe Devisen Zertifikate Hebelzertifikate Fonds ETFs CFDs Top-Themen GodmodeTrader-Blog Suche Hebelzertifikate-Suche Zertifikate-Suche Artikel-Archiv Fonds-Suche ETF-Suche Online-Magazine Gold- und Rohstoff-Report Strategie-Report Traders Journal Forex- und CFD-Report Sonderpublikationen Services Wirtschaftsdaten-Kalender Währungsrechner Tools Mobile Trading-Chat Videos Webinare und Seminare Was ist ein Webinar? BasicMember Newsletter Premium Premium-Services Trading-Services Ausbildungs-Services Börsenbriefe Guidants Pro CD und DVDs LiveOnline-Seminare Partner-Services Videos Bücher Fanartikel Einsteiger und Wissen Börse Trading Charttechnik Wissensmatrix Themen Wissensarchiv Netiquette Videokurs Angaben zu Kurs- und Stammdaten Alle Kursinformationen Fondspreise sowie der WM Datenservice werden von der vwd Vereinigte Wirtschaftsdienste AG geliefert Quelle WM Datenservice Quelle für Derivate-Stammdaten ARIVA DE AG The of Nikkei 225 is owned by Nikkei Inc The Dow Jones IndicesSM are proprietary to and distributed by CME Group Index Services LLC and have been licensed for use For the Terms and Conditions of Use of the Dow Jones IndicesSM please see here Informationen zur Zeitverzögerung der Kursdaten und Börsenbedingungen Alle Angaben ohne Gewähr 2016 BörseGo AG Für die Richtigkeit der dargestellten Kurs- Stamm- und Marktdaten wird keine Haftung übernommen Vergleichen Sie die hier wiedergegebenen Daten mit denen Ihrer Bank oder Ihres Brokers bevor Sie eine Anlage tätigen Rechtliche Hinweise AGB Datenschutzhinweise Haftung Nutzungsgrundlagen Impressum Weiterführende Links Unternehmen Mediadaten Jobs Kontakt 1 24 footer-ad ID 2539120 960px 40px Matched Route - Route Targeting UNKNOWN window adspace footer-ad id 2539120 GodmodeTrader Nach oben springen window twttr function id fjs 0 t window twttr if getElementById id return s id id src https platform twitter comwidgets fjs parentNode insertBefore fjs t e t ready function t e push t widgets load return t document script twitter-wjs function gaProperty UA-44641987-1 disableStr ga-disable- gaProperty if document cookie indexOf disableStr true -1 window disableStr true Opt-out function function gaOptout document cookie disableStr true expires Thu 31 Dec 2099 23 59 59 UTC path window disableStr true window gaOptout function o g r a m GoogleAnalyticsObject r r r function r q r q push arguments r 1 new Date a createElement o m o a async 1 a src g m parentNode insertBefore a m window document script www google-analytics comanalytics ga ga create UA-44641987-1 auto allowLinker true ga require linker ga linker autoLink ssl godmode-trader de ga set anonymizeIp true context http schema org type WebSite url http www godmode-trader de potentialAction type SearchAction target http www godmode-trader dearchiv-suche?search search term string query-input required name search term string window CONFIG segments topic controller segment topic config text toggle isFoldedOut verbergen isFoldedIn anzeigen isSkipped true description controller segment freetext config title u00dcber GodmodeTrader titleClass info boxColor white boxContent Auf den Seiten von GodmodeTrader www godmode-trader de finden Sie kostenlose tagesaktuelle Chartanalysen Prognosen und Aktienanalysen B u00f6rsennews und Echtzeit-Nachrichten Echtzeit-Kurse Trading-Services Angebote zum Thema u201eB u00f6rse u00fcr Einsteiger u201c und vieles mehr GodmodeTrader ist das reichweitenst u00e4rkste Internetportal u00fcr B u00f6rsenhandel Trading technische Analyse und Anlagestrategien im deutschsprachigen Raum T u00e4glich werden hier umfangreiche Chartanalysen von Profi-Tradern Trading-Tipps sowie Hintergrundwissen zu den Themen B u00f6rse Finanzm u00e4rkte Trading Investieren und Anlegen ver u00f6ffentlicht! Zu den Highlights auf den Seiten von GodmodeTrader geh u00f6rt der t u00e4gliche DAX-Tagesausblick von Rocco Gr u00e4fe der konkrete Marken u00fcr das DAX-Trading nennt und der zur Pflichtlekt u00fcre u00fcr zahlreiche Daytrader und Anleger geh u00f6rt Neben dem umfangreichen Gratis-Angebot bietet GodmodeTrader auch kostenpflichtige Analyse- und Trading-Services die von professionellen Tradern und Tradingcoaches betreut werden Hier k u00f6nnen Sie die einzelnen Handelsentscheidungen der Trader live verfolgen selbst nachhandeln und sich mit unseren Profis austauschen! Zudem bietet GodmodeTrader ein umfassendes Ausbildungs- und Webinarangebot u00fcr jeden Anlegertyp vom B u00f6rsenneuling bis zum erfahrenen Daytrader Trading bezeichnet im Gegensatz zum Investieren den eher kurzfristig orientierten Handel von Wertpapieren und anderen Finanzprodukten Anders als ein klassischer Anleger versucht der Trader von Kursschwankungen in einem kurzfristigen Zeithorizont zu profitieren Viele Trader st u00fctzen sich bei ihren Anlageentscheidungen und Aktienempfehlungen auf die Technische Analyse Im Gegensatz zur Fundamentalanalyse die ihre Prognosen auf gesamtwirtschaftliche und unternehmerische Daten st u00fctzt zieht die Chartanalyse Kurs- und Umsatzverl u00e4ufe der Aktien zu Rate Im Rahmen der Chartanalyse wird der historische Kursverlauf eines Index einer Aktie oder eines anderen Finanzinstruments grafisch dargestellt und ausgewertet Die vielf u00e4ltigen Methoden der Chartanalyse liefern dabei signifikante Kauf- und Verkaufssignale Prognosen u00fcber den weiteren Kursverlauf und Kursziele Chartanalyse verbessert damit entscheidend das Timing und die Profitabilit u00e4t von Anlageentscheidungen noPaddign false buttons null isSkipped false special message controller segment special message segment special message config single push enabled true config subscribe history 1 data apiv1 article data in categories id in 2084 api resource article action list attributes title teaser body filter attribute categories id values 2084 type include attribute date values 2016-09-01T21 15 15 02 00 type greater and equal than limit 1 age 900 defaults api resource article action list attributes title teaser body filter attribute categories id values 2084 type include limit 1 item age 900 push enabled false config subscribe history 1 data apiv1 article data in categories id in 2084 isSkipped false topstories controller segment ursula config headline text null classes null defaults api resource article action list limit 3 attributes body slug type typeId autoTeaser author image categories images teaser id url source isSponsored source externalUrl commentCount date single api filter attribute categories id values 1309 type include resource article action list limit 3 attributes body slug type typeId autoTeaser author image categories images teaser id url source isSponsored source externalUrl commentCount date cursor totalCount 3996 page 1 pageSize 3 pages 1332 isSkipped false marketoverview controller segment instrument list segment instrument list config headline level 3 classes text chart interactionResize false height 216 width cols-5 enabled true mode current generators HighLowMarkers config volume false legend true type mountain grid true span 1day interval 60 width 378 height 216 adelement enabled false tabs realtime selected true title Echtzeit api filter attribute listComponentOf id values 604 type include resource instrument action list attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId marketoverview-tab-realtime panelId marketoverview-panel-realtime showactions true showDelayedIcon true ad null top 5 flop 5 mode current view segment instrument list view table html twig skipCols original title Original api filter attribute listComponentOf id values 605 type include resource instrument action list attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision tabId marketoverview-tab-original panelId marketoverview-panel-original showactions true showDelayedIcon true ad null top 5 flop 5 mode current view segment instrument list view table html twig skipCols single null defaults item showactions true showDelayedIcon true ad null top 5 flop 5 mode current view segment instrument list view table html twig skipCols api resource instrument action list attributes id name fullName slug assetClass id refQuotation quote refQuotation instrumentAliasName refQuotation quoteSource precision title Markt u00fcberblick titleClass chart-line isSkipped false live box controller segment live box segment live box config headline enabled true level 3 text GodmodeTrader Newsticker classes icon-news article enabled true title Nachrichten limit 10 instrument enabled false input placeholder Nach Basiswert filtern instrumentPreview enabled false ad bottom enabled false id null right enabled false id null infinite enabled true maximum 10 firstInFirstOut enabled false setting enabled false sound enabled false hotkey enabled false jumpToFirstArticle true jumpToLastArticle true jumpToNextArticle true jumpToPreviousArticle true adoptInstrument enabled false selector null attribute null useInstrumentName false button text Nur Nachrichten zu classes button content expandable true timestamp false lastUpdate enabled false comment enabled true limit 10 title User-Kommentare infinite enabled false maximum 10 firstInFirstOut enabled false popout enabled true text In neuem Fenster u00f6ffnen isStateless true tabs article title Nachrichten tabId tab-article panelId panel-article comment title User-Kommentare tabId tab-comment panelId panel-comment isSkipped false news de europa controller segment article list segment article list config headline level 3 classes icon-region ger-eur text Deutschland und Europa wrapper classes box-wrap clearfix tabs analyses title Chartanalysen und Nachrichten selected true api filter attribute categories id values 20 type include resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 10 archiveButton enabled true auto true classes button right icon-arrow-right text Zum Chartanalysen und Nachrichten Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 20 target self tabId news-de-europa-tab-analyses panelId news-de-europa-panel-analyses skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null dax title DAX-Aktien api filter attribute instruments id values 118548 118686 118687 118693 118817 118955 119092 119102 119104 119234 120815 120823 121448 121676 121679 121684 121841 121955 121981 122006 122030 122037 122085 122096 122105 122117 122118 122121 123011 123104 type include attribute categories id values 20 type include resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 10 archiveButton enabled true auto true classes button right icon-arrow-right text Zum DAX-Aktien Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter instruments id 118548 118686 118687 118693 118817 118955 119092 119102 119104 119234 120815 120823 121448 121676 121679 121684 121841 121955 121981 122006 122030 122037 122085 122096 122105 122117 122118 122121 123011 123104 categories id 20 target self tabId news-de-europa-tab-dax panelId news-de-europa-panel-dax skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null ach title u00d6sterreich und Schweiz api filter attribute categories id values 20 type include attribute countries id values 5 61 type include resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 10 archiveButton enabled true auto true classes button right icon-arrow-right text Zum u00d6sterreich und Schweiz Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 20 countries id 5 61 target self tabId news-de-europa-tab-ach pa urrency skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 2 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null commodity title Rohstoffe api filter attribute instruments assetClass id values 4 type include attribute categories id values 2118 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 6 archiveButton enabled true auto false classes button right icon-arrow-right text Zum Nachrichten-Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 2118 instruments assetClass id 4 target self tabId commodity-currency-tab-commodity panelId commodity-currency-panel-commodity skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 2 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null single null skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 2 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null api resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl limit 6 isSkipped false news world controller segment article list segment article list config headline level 3 classes icon-news text Nachrichten weltweit wrapper classes box-wrap clearfix tabs all selected true title Alle api filter attribute categories id values 2116 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 6 archiveButton enabled true auto false classes button right icon-arrow-right text Zum Nachrichten-Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 2116 target self tabId news-world-tab-all panelId news-world-panel-all skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 2 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null asia title Asien und Emerging Markets api filter attribute countries id values 537 type include attribute categories id values 2116 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 6 archiveButton enabled true auto false classes button right icon-arrow-right text Zum Nachrichten-Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 2116 countries id 537 target self tabId news-world-tab-asia panelId news-world-panel-asia skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 2 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null single null skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled true count 2 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null api resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl limit 6 isSkipped false news stock company controller segment article list segment article list config headline level 3 classes icon-news text Analysteneinsch u00e4tzungen zu Aktien und Unternehmen wrapper classes box-wrap clearfix tabs all selected true title Alle api filter attribute categories id values 2119 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 8 archiveButton enabled true auto false classes button right icon-arrow-right text Alle Analysteneinsch u00e4tzungen textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 2119 target self tabId news-stock-company-tab-all panelId news-stock-company-panel-all skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null europe title Europa api filter attribute categories id values 2119 type include attribute countries regions id values 542 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 8 archiveButton enabled true auto false classes button right icon-arrow-right text Alle Analysteneinsch u00e4tzungen Europa textDefault false link archiv-suche?tab search-archive-tab-articles und filter countries regions id 542 categories id 2119 target self tabId news-stock-company-tab-europe panelId news-stock-company-panel-europe skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null na title Nordamerika api filter attribute categories id values 2119 type include attribute countries regions id values 539 type include attribute typeId values 20 type exclude resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored limit 8 archiveButton enabled true auto false classes button right icon-arrow-right text Alle Analysteneinsch u00e4tzungen Nordamerika textDefault false link archiv-suche?tab search-archive-tab-articles und filter countries regions id 539 categories id 2119 target self tabId news-stock-company-tab-na panelId news-stock-company-panel-na skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null single null skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false hot enabled false count null backgroundColor null classes null appendAuthor enabled false image enabled false type null width null height null api resource article action list attributes body author slug commentCount teaser images teaser id source externalUrl limit 8 isSkipped false news certificates funds etfs controller segment article list segment article list config headline level 3 classes icon-news text Zertifikate- Fonds- und ETF-News wrapper classes box-wrap clearfix tabs null single archiveButton enabled true auto true classes button right icon-arrow-right text Zum Zertifikate- Fonds- und ETF-News Archiv textDefault false link archiv-suche?tab search-archive-tab-articles und filter categories id 2117 target self hot enabled true count 1 backgroundColor null classes null appendAuthor enabled false image enabled true type teaser width null height null api limit 4 attributes body author slug commentCount teaser images teaser id source externalUrl isSponsored filter attribute categories id values 2117 type include attribute typeId values 20 type exclude resource article action list skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit null loginNeeded false listClasses null horizontal enabled false columns null ellipsis enabled false config height 36 watch false skipIfEmpty true defaults item skip null description null external false emptyText Keine Eintr u00e4ge vorhanden buttons null boxColor null classes null slideshow enabled false rotationTimeout 5000 disableLink false accordion enabled false supportVisual enabled false source null title null ad enabled false id null push enabled false template jandaya highlight false config null glossary enabled false show title true author true comment true teaser true teaserOnImage false date true textOnImage true archiveButton enabled false auto false classes button text Zum Archiv textDefault false link null target self readMoreLink text mehr hiddenToggle enabled false selector null text null pagination false visibleLimit nu de Lassen Sie sich diesen Wissensvorsprung nicht entgehen und melden Sie sich gleich an! Kostenlose Anmeldung Abmeldung jederzeit m u00f6glich n newsletter id 113 modalId newsletterRegisterFromHeadline textAlreadySubscribed - textSubscribe textSuccessLoggedIn Vielen Dank u00fcr die Anmeldung textSuccessAnonymous Wir haben Ihnen eine E-Mail gesendet Bitte kontrollieren Sie ihr Postfach textInvalidEmailAddress Ung u00fcltige E-Mail Adresse modal title Jetzt einfach kostenlos anmelden content isSkipped false tab controller segment navigation config file false activeClass act adjustWidth false useQueryString true configNode null children true searchable false classes left active null marketoverview enabled false push true map 133942 name ES50 133965 name DJIA 133978 name u00d6l 133955 name NDQ api resource instrument action list attributes id name assetClass id slug fullName refQuotation quote precision filter attribute listComponentOf id values 625 type include isSkipped false ad tab controller segment navigation config file false activeClass act adjustWidth false useQueryString true configNode null children true searchable false classes rightAligned right active null marketoverview enabled false push true map 133942 name ES50 133965 name DJIA 133978 name u00d6l 133955 name NDQ api resource instrument action list attributes id name assetClass id slug fullName refQuotation quote precision filter attribute listComponentOf id values 625 type include baseNode navigation ad noneActive true isSkipped false super banner controller segment ad segment ad config type super-banner isSkipped false skyscraper controller segment ad segment ad config type skyscraper isSkipped false super banner 1000 controller segment ad segment ad config type super-banner-1000 isSkipped false skyscraper rechts controller segment ad segment ad config type skyscraper-rechts isSkipped false skyscraper links controller segment ad segment ad config type skyscraper-links isSkipped false billboard controller segment ad segment ad config type billboard isSkipped false bottombar ad controller segment bottombar ad segment bottombar ad config cookieKey isBottombarAdClosed include bannertestumgebung isActive true isSkipped false ad dispatch controller segment ad segment ad config dispatch true allAdSpaces super-banner id 2536031 type super-banner active true width 1000 height 90 renderOrder 1 automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute skyscraper id 2536032 type skyscraper active true width 200 height 800 renderOrder 2 automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute skyscraper-links id 3098698 type skyscraper-links active true width 200 height 800 renderOrder 3 automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute billboard id 2806237 type billboard active false width 980 height 250 renderOrder 4 automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute medium-rectangle id 2536323 type medium-rectangle active true width 378 height 300 renderOrder null automaticResize null scale null border true enableSponsoredLabel null enableHeadline true route matchedRoute content-box id 2670154 type content-box active true width 538 height 99 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL sponsoring-banner-oben id 2670155 type sponsoring-banner-oben active true width 378 height 60 renderOrder null automaticResize null scale null border true enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL sponsoring-banner-unten id 2670156 type sponsoring-banner-unten active true width 378 height 60 renderOrder null automaticResize null scale null border true enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL footer-ad id 2539120 type footer-ad active true width 960 height 40 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute stoerer-ergebnisliste-anlageprodukte id 2840912 type stoerer-ergebnisliste-anlageprodukte active true width 698 height 50 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL stoerer-ergebnisliste-hebelprodukte id 2840913 type stoerer-ergebnisliste-hebelprodukte active true width 698 height 50 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL stoerer-ergebnisliste-etfs id 3099040 type stoerer-ergebnisliste-etfs active true width 698 height 50 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL content-rectangle id 2697213 type content-rectangle active true width 250 height 250 renderOrder null automaticResize null scale null border true enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL produktbox-analyse id 2700897 type produktbox-analyse active true width 150 height 20 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL sponsoring-line id 2691500 type sponsoring-line active true width 938 height 65 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL promolink-suche id 2650230 type promolink-suche active true width 570 height 30 renderOrder null automaticResize null scale null border true enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL jetzt-handeln-button-1 id 2647021 type jetzt-handeln-button-1 active true width 130 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL jetzt-handeln-button-2 id 2647022 type jetzt-handeln-button-2 active false width 130 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL jetzt-handeln-button-3 id 2650186 type jetzt-handeln-button-3 active false width 130 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL jetzt-handeln-button-4 id 2650194 type jetzt-handeln-button-4 active false width 130 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL jetzt-handeln-button-5 id 2650203 type jetzt-handeln-button-5 active false width 130 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL sponsoring-banner-7cols id 2774320 type sponsoring-banner-7cols active true width 538 height 60 renderOrder null automaticResize null scale null border true enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL sponsoring-banner-gold id 2778784 type sponsoring-banner-gold active false width 298 height 78 renderOrder null automaticResize null scale null border true enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-1 id 2909941 type comment-banner-1 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-2 id 2909944 type comment-banner-2 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-3 id 2909946 type comment-banner-3 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-4 id 2909948 type comment-banner-4 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-5 id 2909949 type comment-banner-5 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-6 id 2909951 type comment-banner-6 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-7 id 2909952 type comment-banner-7 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-8 id 2909954 type comment-banner-8 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-9 id 2909955 type comment-banner-9 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL comment-banner-10 id 2909957 type comment-banner-10 active true width 598 height 60 renderOrder null automaticResize null scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute GLOBAL pop-up id 2763039 type pop-up active false width 1 height 1 renderOrder null automaticResize true scale null border null enableSponsoredLabel null enableHeadline null route matchedRoute tops-flops-startseite-dax id 3130548 type tops-flops-startseite-dax active false width 378 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel true enableHeadline null route matchedRoute GLOBAL tops-flops-startseite-mdax id 3131597 type tops-flops-startseite-mdax active false width 378 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel true enableHeadline null route matchedRoute GLOBAL tops-flops-startseite-sdax id 3131598 type tops-flops-startseite-sdax active false width 378 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel true enableHeadline null route matchedRoute GLOBAL tops-flops-startseite-tecdax id 3131599 type tops-flops-startseite-tecdax active false width 378 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel true enableHeadline null route matchedRoute GLOBAL tops-flops-startseite-dowjones id 3131600 type tops-flops-startseite-dowjones active false width 378 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel true enableHeadline null route matchedRoute GLOBAL tops-flops-startseite-nasdaq id 3131601 type tops-flops-startseite-nasdaq active false width 378 height 30 renderOrder null automaticResize null scale null border null enableSponsoredLabel true enableHeadline null route matchedRoute GLOBAL targetingParams isSkipped false sitemap controller null segment sitemap config columns quotes charts title Kurse und Charts rows title Indizes link kurse-und-charts indizes title Devisen-Kurse link kurse-und-charts devisen title Rohstoff-Kurse link kurse-und-charts rohstoffe title Sektoren link kurse-und-charts sektoren title Anleihen link kurse-und-charts anleihen title Realtime Kurse link kurse-und-charts realtime-kurse categories title Ressorts rows title Rohstoffe link rohstoffe title Devisen link devisen title Zertifikate link zertifikate title Hebelzertifikate link hebelzertifikate title Fonds link fonds title ETFs link etfs title CFDs link cfds title Top-Themen link topthemen title GodmodeTrader-Blog link godmode-trader-blog search title Suche rows title Hebelzertifikate-Suche link hebelzertifikate suche title Zertifikate-Suche link zertifikate suche title Artikel-Archiv link archiv title Fonds-Suche link fonds suche title ETF-Suche link etfs suche magazine title Online-Magazine rows title Gold- und Rohstoff-Report link rohstoffe gold-und-rohstoff-report title Strategie-Report link zertifikate strategie-report title Traders Journal link hebelzertifikate traders-journal title Forex- und CFD-Report link devisen forex-cfd-report title Sonderpublikationen link publikationen sonderpublikationen services title Services rows title Wirtschaftsdaten-Kalender link wirtschaftsdaten-kalender title u00e4hrungsrechner link devisen waehrungsrechner title Tools link tools title Mobile link mobile title Trading-Chat link blogs title Videos link videos title Webinare und Seminare link webinare-und-seminare title Was ist ein Webinar? link webinare-und-seminare was-ist-ein-webinar title BasicMember link basicmember title Newsletter link newsletter premium title Premium rows title Premium-Services link premium premium-services title Trading-Services link premium trading-services title Ausbildungs-Services link premium ausbildungs-services title B u00f6rsenbriefe link premium boersenbriefe title Guidants Pro link premium guidants title CD und DVDs link premium produkte title Live Online-Seminare link premium live-online-seminare title Partner-Services link premium partner-services title Videos link premium videos title B u00fccher link premium buecher title Fanartikel link premium fanartikel knowledge title Einsteiger und Wissen rows title B u00f6rse link einsteiger-und-wissen boerse title Trading link einsteiger-und-wissen trading title Charttechnik link einsteiger-und-wissen charttechnik title Wissensmatrix link einsteiger-und-wissen matrix title Themen link themen title Wissensarchiv link einsteiger-und-wissen wissensarchiv title Netiquette link netiquette title Videokurs link einsteiger-und-wissen videoreihen erfolgreich-traden-von-a-z isSkipped false layout controller layout base config announcement title push config subscribe history 10 fields id title slug autoTeaser images teaser source externalUrl typeId date data apiv1 article data in categories id in 1742 segment no script segment hotline primary true config title null headline Aktivieren Sie JavaScript um sich anzumelden! body Sehr geehrter User dieser Inhalt kann leider nicht korrekt dargestellt werden Daf u00fcr kann es zwei M u00f6glichkeiten geben a Sie verwenden einen alten Browser zum Beispiel Internet Explorer 8 Bitte aktualisieren Sie Ihren Browser um unsere Webseite mit allen Funktionen nutzen zu k u00f6nnen b Sie haben JavaScript deaktiviert Bitte aktivieren Sie JavaScript in Ihrem Browser um auf unserer Seite ohne Einschr u00e4nkungen zu surfen So aktivieren Sie JavaScript Mozilla Firefox Internet Explorer Google Chrome Safari Ihr Team von GodmodeTrader de n color yellow image null navBar segment navigation config tag main searchable true sticky false marketoverview enabled true metaNavBar segment navigation view meta html twig config tag headline sticky false mailinglistId 113 mailinglistModalText Mit dem GodmodeNewsletter erhalten Sie regelm u00e4 u00dfig n u00fctzliche Informationen zu den verschiedenen Leistungen und Angeboten von GodmodeTrader de Lassen Sie sich diesen Wissensvorsprung nicht entgehen und melden Sie sich gleich an! Kostenlose Anmeldung Abmeldung jederzeit m u00f6glich n newsletter id 113 modalId newsletterRegisterFromHeadline textAlreadySubscribed - textSubscribe textSuccessLoggedIn Vielen Dank u00fcr die Anmeldung textSuccessAnonymous Wir haben Ihnen eine E-Mail gesendet Bitte kontrollieren Sie ihr Postfach textInva Realtimekurse Finanz- und Börsennews Chartanalysen GodmodeTrader function push gtm start new Date getTime gtm dataLayer ? und async true src www googletagmanager comgtm js?id dl parentNode insertBefore window document script dataLayer GTM-K3V8TJ window DYNAMIC ! false if window DYNAMIC b document body b className b className replace bnoScript b Einsteiger und Wissen Webinare und Seminare Videos Magazine Chat Blog Tools Mobile Newsletter Feedback und Hilfe Feedback Sie haben Fragen Wünsche Anregungen oder Probleme bei der Nutzung unserer Services? Nutzen Sie unsere Feedback-Funktion und übermitteln Sie uns direkt und auf dem schnellsten Weg Ihre Anfrage! mehr FAQ Eine Sammlung der häufigsten und wichtigsten Fragen rund um unsere Services und Angebote Ist die Mitgliedschaft als BasicMember wirklich kostenfrei? Wie kann ich Kontakt zu den Tradern aufnehmen? Hier finden Sie die Antworten mehr Login Registrieren Profil bearbeiten Einstellungen Abonnements Logout Mein Profil GodmodeMembers Realtimekurse Finanz- und Börsennews Chartanalysen GodmodeTrader zur Startseite skyscraper-links ID 3098698 200px 800px Matched Route - Route Targeting UNKNOWN window adspace skyscraper-links id 3098698 renderOrder 3 super-banner ID 2536031 1000px 90px Matched Route - Route Targeting UNKNOWN window adspace super-banner id 2536031 renderOrder 1 skyscraper ID 2536032 200px 800px Matched Route - Route Targeting UNKNOWN window adspace skyscraper id 2536032 renderOrder 2 Aus Sicherheitsgründen stehen Pushkurse in ihrem Benutzerkonto nicht zur Verfügung Die Kurse aktualisieren sich automatisch sobald Sie das Benutzerkonto verlassen DAX 10 555 50-0 35 ES50 3 025 000 12 DJIA 18 378 00-0 12 NDQ 4 774 000 06 Gold 1 313 750 36 EURUSD 1 11970 36 Öl 45 555-3 00 EUR Ihre Watchlist ist noch leer Befüllen sie über Ihr Benutzerprofil! Klicken Sie hier um in dieser Kursleiste eine Liste mit den Aktien Rohstoffen oder Devisen Ihrer Wahl anzuzeigen Startseite Suche Suchen Erweiterte Suche function search document getElementById searchinput function isPlaceholderSupported test document input return placeholder in test if isPlaceholderSupported search setAttribute placeholder Suche WKN return search onfocus function if this value trim Suche WKN this value search onblur function if this value trim this value Suche WKN Kurse und Charts Rohstoffe Devisen Zertifikate Hebelzertifikate Fonds ETFs CFDs Premium unc resolver new RegExp ? ? encodeURI godmode settings replace - g und container document body function updateNavigationClasses config JSON parse decodeURI document cookie replace unc resolver 1 hasMarketOverview config und config hasOwnProperty marketoverview ? config marketoverview true hasHeadbar config und config hasOwnProperty navigation ? config navigation true currentClasses unc container className split classMap key for key currentClasses length key if currentClasses key continue classMap currentClasses key null if !hasMarketOverview und classMap hasOwnProperty hasMarketOverview classMap hasMarketOverview remove else if hasMarketOverview und !classMap hasOwnProperty hasMarketOverview classMap hasMarketOverview add if !hasHeadbar und classMap hasOwnProperty hasHeadbar classMap hasHeadbar remove else if hasHeadbar und !classMap hasOwnProperty hasHeadbar classMap hasHeadbar add for key in classMap if null classMap key if add classMap key unc container className key if remove classMap key unc container className unc container className replace key updateNavigationClasses function document getElementsByClassName ? function e q return e getElementsByClassName q function e q return e querySelectorAll q hNav document getElementById h-nav navItems hNav nav-item navHome document navHome navSearchItem document navSearchItem navPremium document navPremium navItemsWidth forgiven remaining interval current lastItem paddingList paddingRight if !hNav und !navHome und !navSearchItem und !navPremium und !navItems return false update other stuff navHome navSearchItem navSearchItem navPremium forgiven navHome offsetWidth navSearchItem offsetWidth navPremium offsetWidth for interval navItems length interval current navItems interval forgiven current offsetWidth remaining hNav offsetWidth - forgiven lastItem navItems length - 1 a if !lastItem und lastItem length ! 1 return false lastItem paddingLeft paddingRight 13 if remaining 2 ! paddingRight 1 remaining - 1 paddingLeft remaining 2 paddingRight remaining 2 lastItem style paddingLeft px lastItem style paddingRight px HPE vor Verkauf der Software-Sparte? - Wöchentliche US-Erstanträge leicht unter den Erwartungen 17 13 und ndash von GodmodeTrader-Team Xetra-Gold Deutsche Börse bezieht Stellung 16 32 und ndash von Oliver Baron 24 DEUTSCHE BANK vs COMMERZBANK 10 10 und ndash von Rene Berteit 6 HPE vor Verkauf der Software-Sparte? - Wöchentliche US-Erstanträge leicht unter den Erwartungen Immer bestens informiert Mit dem News-Flash auf Godmode-Trader de haben Sie die wichtigsten Ereignisse des Tages auf einen Blick! Artikel lesen Bild Sergey Nivens Fotolia com Xetra-Gold Deutsche Börse bezieht Stellung 24 Nach unserem gestrigen Artikel zu Xetra-Gold hat die Deutsche Börse Commodities GmbH eine Stellungnahme veröffentlicht Fazit Eine physische Auslieferung ist nur möglich wenn die jeweilige Bankfiliale auch mitspielt Artikel lesen Bild DedPixto Fotolia com DEUTSCHE BANK vs COMMERZBANK 6 Na wenigstens in einem Sektor steppt der Bulle Die Banken führen auch heute die Gewinnerlisten an Wer aber hat intern die Nase vorn? Artikel lesen Bild Eisenhans Fotolia com LIVE! Von A wie Apple bis Z wie Zynga Godmode TV mit Bastian Galuschka Sendung jetzt starten Ihre Werte technisch unter die Lupe genommen Wo liegen Unterstützungen und Widerstände im Chart? Wo bieten sich Absicherungen für bestehende Long-Positionen an? Sendung schließen Weitere Videos ANZEIGE Deutschland und Europa Chartanalysen und Nachrichten DAX-Aktien Österreich und Schweiz Täglich Gewinne mit dem Highspeed Daytrader 1 20 20 - Der Monat August hatte 23 Handelstage und in meinem Account den ich unteranderem im Highspeed Daytrader handele konnte ich alle 23 Handelstage im Gewinn abschließen Aktuell bin ich bei 29 Gewinntagen in Folge im Account von H Behrendt mehr 18 00 - Der Tag an den Märkten - Ausblick auf die Non Farm Payrolls von B Galuschka 17 15 - LUFTHANSA - Die Bullen retten sich über die Zeit von R Berteit 16 33 - EVONIK - So sehen frischgebackene Bullen aus von R Berteit 16 03 - BEIERSDORF - Verkaufen rät JPM! von R Berteit 15 29 - JUNGHEINRICH - Rally zu erwarten! von R Berteit 15 02 - LEONI - Das sieht weiterhin überzeugend aus von R Berteit 14 14 - RHEINMETALL - Mit Schmackes über den Widerstand von B Galuschka 13 44 - DAX Mittagsausblick - Vom Regen in die Traufe von R Berteit 13 18 - DEUTSCHE POST EUR Kaufwelle noch immer möglich von A Paulus Zum Chartanalysen und Nachrichten Archiv LUFTHANSA - Die Bullen retten sich über die Zeit 17 15 - Das bärische symmetrische Dreieck in der Lufthansa-Aktie verliert an Aussagekraft da die Kurse in die Spitze dieser Formation hineingelaufen sind Was ist jetzt zu erwarten? von R Berteit mehr 16 03 - BEIERSDORF - Verkaufen rät JPM! von R Berteit 13 18 - DEUTSCHE POST EUR Kaufwelle noch immer möglich von A Paulus 12 15 - ADIDAS EUR Konsolidierung in wichtiger Phase von A Paulus 11 08 - BMW- Ausbruchsversuch läuft von A Paulus 10 10 - DEUTSCHE BANK vs COMMERZBANK von R Berteit 6 09 48 - DAIMLER Intraday EUR Startet ein neuer Rallyschub? von A Paulus 31 08 2016 - Der Tag an den Märkten - Bankenaktien für Trader interessant von B Galuschka 2 31 08 2016 - BAYER - Zunehmende Hängepartie für die Bullen von R Berteit 31 08 2016 - MERCK KGaA EUR Noch etwas abwärts von A Paulus Zum DAX-Aktien Archiv GIVAUDAN EUR Noch ein Rücksetzer und dann Rally? 09 25 - Die Givaudan-Aktie befindet sich seit einigen Wochen in einer Konsolidierung Diese dürfte auch noch etwas andauern von A Paulus mehr 08 40 - SMI EUR Kaufsignal negiert von A Paulus 31 08 2016 - VIENNA INSURANCE - Ein Hoffnungsschimmer von A Rain 1 31 08 2016 - SMI - Kleiner Boden vollendet von A Paulus 30 08 2016 - SMI EUR Chance auf Bodenbildung intakt von A Paulus 29 08 2016 - SMI EUR Kleines Kaufsignal von A Paulus 26 08 2016 - SMI EUR Chance auf kleinen Boden von A Paulus 25 08 2016 - SMI EUR Jahreshoch bleibt im Blickfeld von A Paulus 24 08 2016 - SMI EUR Da geht noch was von A Paulus 23 08 2016 - SMI EUR Kleines Kaufsignal möglich von A Paulus Zum Österreich und Schweiz Archiv US-Märkte CH ROBINSON - Logistiker startet 20 31 - Anfang des Jahres hat der Wert eine Rally von rund 20 vollzogen und seitdem korrigiert Zuletzt wurde der Wert über Wochen im Unterstützungsbereich zwischen gekauft und bricht nun zur Oberseite aus von T Krieg mehr 20 02 - HALLIBURTON - Großes Top und Tschüss von T Krieg 19 33 - Das große Comeback der US-Versicherer? von T Krieg 19 04 - AUTODESK - Neues Allzeithoch 2 von T Krieg 18 32 - EXPEDIA - Möglicher Börsengang von Trivago von B Galuschka 17 54 - MCDONALDS - Big Mäc? Nein Danke! von H Philippson 1 17 00 - US Aktien im Fokus FISERV WYNN RESORTS von B Galuschka 16 40 - STARBUCKS - Kalter Kaffee? von H Philippson 3 15 58 - US INDIZES - Der nächste Akt im Trauerspiel von B Galuschka 1 15 26 - US Ausblick Eine gute und eine schlechte Nachricht von B Galuschka Zum US-Märkte Archiv Devisen und Rohstoffe Chartanalysen und Nachrichten Edelmetalle Devisen FX-Mittagsbericht US-Dollar setzt Rallye fort 13 10 - Der US-Dollar hat dank der verbesserten US-Zinsaussichten am Donnerstag gegenüber den anderen Hauptwährungen mit Ausnahme von GBPUSD weiterhin die Nase vorn von T Hansmann mehr 09 46 - JFD Devisenradar USDJPY bietet erneute Short-Möglichkeit von C Kämmerer 08 56 - EURUSD - Geduldsprobe für Trader von H Philippson 08 38 - Platin - Einbruch in geordneten Bahnen von M Strehk 08 35 - Öl - Tagesausblick für Donnerstag 01 September 2016 von M Strehk 31 08 2016 - FX-Mittagsbericht US-Dollar im Seitwärtsschritt von T Hansmann 31 08 2016 - JFD Devisenradar Wann zieht der Goldpreis wieder an? von C Kämmerer 3 Zum Chartanalysen und Nachrichten Archiv Platin - Einbruch in geordneten Bahnen 08 38 - Es geht bei Platin unverändert abwärts Die klar abgrenzbare Formationslage bietet aber die Chance die laufende Korrektur bald zu beenden von M Strehk mehr 31 08 2016 - JFD Devisenradar Wann zieht der Goldpreis wieder an? von C Kämmerer 3 31 08 2016 - Palladium in den Startlöchern von M Strehk 1 30 08 2016 - Gold - Es ist noch etwas Zeit von M Strehk 29 08 2016 - SILBER - Topbildung setzt sich durch von M Strehk 26 08 2016 - Platin - Kleine Chance für die Bullen ist da von M Strehk 25 08 2016 - Palladium formiert sich bullisch von M Strehk Zum Edelmetalle Archiv FX-Mittagsbericht US-Dollar setzt Rallye fort 13 10 - Der US-Dollar hat dank der verbesserten US-Zinsaussichten am Donnerstag gegenüber den anderen Hauptwährungen mit Ausnahme von GBPUSD weiterhin die Nase vorn von T Hansmann mehr 09 46 - JFD Devisenradar USDJPY bietet erneute Short-Möglichkeit von C Kämmerer 08 56 - EURUSD - Geduldsprobe für Trader von H Philippson 31 08 2016 - FX-Mittagsbericht US-Dollar im Seitwärtsschritt von T Hansmann 31 08 2016 - EURUSD - Abwärtstrendkanal dominiert das Bild von H Philippson 30 08 2016 - GBPJPY - Der Drachen ist noch im Sommerurlaub! von H Philippson 30 08 2016 - EURCHF - Wichtige Hürden genommen von H Philippson Zum Devisen Archiv Kommentare zu Wirtschaft Börse und Politik Xetra-Gold Deutsche Börse bezieht Stellung 24 16 32 - Nach unserem gestrigen Artikel zu Xetra-Gold hat die Deutsche Börse Commodities GmbH eine Stellungnahme veröffentlicht Fazit Eine physische Auslieferung ist nur möglich wenn die jeweilige Bankfiliale auch mitspielt von O Baron mehr NEWSLINK - September der heisse Monat für die Zentralbanken 12 28 - Im September fallen rund um die Welt geldpolitische Entscheidungen - Widersprüchliche Konjunkturdaten Fragezeichen hinter Chinas Wirtschaft - Abgasskandal Auch Australien verklagt VW von Newslink mehr ÖL Kommt der OPEC-Deal doch noch? 1 06 27 - Seit über einem Jahr spricht die OPEC über eine Förderobergrenze Geschehen ist bisher nichts Jetzt wird es allerdings ernst von C Schmale mehr Australien Das Beste aus zwei Börsenwelten 31 08 2016 - Wandel in den Anlegerpräferenzen von den Industrie- zu den Schwellen- und Entwicklungsländern Australien kombiniert die Vorteile beider Welten Es ist Industrie- und Entwicklungsland zugleich Die von M Hüfner mehr Großbritannien Immer noch keine Krise in Sicht 3 31 08 2016 - Der Entscheid Großbritanniens die EU zu verlassen hat in mehreren Hinsichten überrascht An vorderster Front steht die Wirtschaft von C Schmale mehr 31 08 2016 - Xetra-Gold Doch nur ein Fetzen Papier? von O Baron 35 31 08 2016 - Gemische Datenlage - warten auf US-Jobmarkt von Hellmeyer 1 Mehr aus Wirtschaft Börse und Politik Marktüberblick Echtzeit Original Name Kurs - abs - Zeit und DAX 10 555 00 -37 69 -0 36 21 29 35 DB TecDAX 1 737 00 9 57 55 21 29 34 MDAX 21 496 00 99 04 46 21 29 51 EUROSTOXX 3 025 00 3 50 12 21 29 54 DB Dow Jones 18 378 00 -22 88 -0 12 21 30 08 DB und P500 2 165 50 -5 45 -0 25 21 30 09 NAS100 4 774 00 2 95 06 21 30 14 DB Nikkei 225 16 950 00 62 60 37 21 29 15 Hang Seng 23 107 59 159 82 70 16 44 59 EURUSD 1 1198 0041 37 21 30 06 Gold 1 313 75 4 75 36 21 29 49 Brent Crude Öl 45 565 -1 400 -2 98 21 30 09 Euro-Bund Future 167 39 10 06 21 27 37 Name Kurs - abs - Zeit DAX 10 534 31 -58 38 -0 55 17 45 00 TecDAX 1 732 98 5 55 32 17 45 00 MDAX 21 452 80 55 84 26 17 45 00 EURO STOXX 50 3 017 49 -5 64 -0 19 17 50 00 Dow Jones Industrial Average 18 377 80 -23 08 -0 13 21 15 12 und P 500 2 165 47 -5 48 -0 25 21 15 14 Nasdaq-100 4 774 53 3 48 07 21 15 12 Nasdaq Composite 5 214 55 1 33 03 21 15 12 SMI 8 142 64 -59 19 -0 72 17 30 49 EURUSD 1 1198 0041 37 21 30 06 DJ Transportation Avg Index 7 884 45 5 76 07 21 15 12 CAC 40 4 439 67 1 45 03 18 05 01 AEX 453 87 -0 51 -0 11 18 00 00 TopsFlops DAX MDAX SDAX TecDAX Dow Jones Nasdaq Name Kurs - abs - Zeit Commerzbank AG 6 430 124 1 97 17 29 59 Linde AG 156 300 2 750 1 79 17 35 23 Deutsche Lufthansa AG 10 615 170 1 63 17 35 07 ThyssenKrupp AG 21 145 250 1 20 17 35 05 Bayer AG 93 880 -2 090 -2 18 17 35 23 Beiersdorf AG 81 160 -2 250 -2 70 17 35 02 RWE AG 14 230 -0 435 -2 97 17 35 10 E ON SE 8 007 -0 250 -3 03 17 35 24 Zur Kursliste Name Kurs - abs - Zeit KRONES AG 88 120 2 420 2 82 17 35 53 Jungheinrich AG 28 970 790 2 80 17 35 47 Ströer SE 42 350 835 2 01 17 35 37 Gerresheimer AG 75 760 1 310 1 76 17 35 41 STADA Arzneimittel AG 47 665 -0 475 -0 99 17 35 36 Covestro AG 46 195 -0 485 -1 04 17 35 48 Südzucker AG 23 165 -0 245 -1 05 17 35 49 Steinhoff Internatl Hldgs N V 5 339 -0 068 -1 26 17 59 51 Zur Kursliste Name Kurs - abs - Zeit GRAMMER AG 53 810 1 810 3 48 17 35 55 Ferratum Oyj 21 794 583 2 75 18 36 04 Tele Columbus AG 8 248 182 2 26 17 35 51 Braas Monier Building Group SA 21 550 281 1 32 09 11 51 WCM Beteil u Grundbesitz AG 3 133 -0 056 -1 76 17 35 36 HAMBORNER REIT AG 10 360 -0 195 -1 85 17 35 47 SGL CARBON SE 11 195 -0 345 -2 99 17 35 54 Klöckner und Co SE 11 790 -0 830 -6 58 17 35 50 Zur Kursliste Name Kurs - abs - Zeit Drägerwerk AG und Co KGaA Vz 64 900 2 160 3 44 17 35 28 ADVA Optical Networking SE 7 861 191 2 49 17 35 14 Nemetschek AG 54 500 1 140 2 14 17 35 21 GFT Technologies SE 19 820 385 1 98 17 35 05 SMA Solar Technology AG 31 030 -0 390 -1 24 17 35 05 STRATEC Biomedical AG 55 010 -0 840 -1 50 17 35 28 Telefnica Dtl Hldg AG 3 622 -0 062 -1 68 17 35 22 Siltronic AG 18 895 -0 380 -1 97 17 35 26 Zur Kursliste Name Kurs - abs - Zeit Wal-Mart Stores Inc 72 710 1 270 1 78 21 15 14 N lidEmailAddress Ung u00fcltige E-Mail Adresse modal title Jetzt einfach kostenlos anmelden content tab segment navigation view tabs html twig sticky false config classes left children true ad tab segment navigation view tabs html twig sticky false config baseNode navigation ad noneActive true classes rightAligned right children true super banner segment ad config type super-banner skyscraper segment ad config type skyscraper super banner 1000 segment ad config type super-banner-1000 skyscraper rechts segment ad config type skyscraper-rechts skyscraper links segment ad config type skyscraper-links billboard segment ad config type billboard bottombar ad segment bottombar ad ad dispatch segment ad view dispatch html twig config dispatch true sitemap segment sitemap social link feed title RSS-Feeds url feeds youtube title Youtube url https www youtube com user GodmodeTrader blank true gplus title Google url https plus google com 104912097954325351873 posts blank true twitter title Twitter url http twitter com GodmodeTrader blank true facebook title Facebook url http www facebook com godmodetrader de blank true site controller null config title Realtimekurse Finanz- und B u00f6rsennews Chartanalysen ttl 30 advertisement enabled true meta description Kostenlose Chartanalysen aktuelle B u00f6rsennews Echtzeit-Kurse B u00f6rse u00fcr Einsteiger bietet Europas unabh u00e4ngiges Finanzportal GodmodeTrader de title Realtimekurse Finanz- und B u00f6rsennews Chartanalysen segment topic config description segment freetext config title u00dcber GodmodeTrader titleClass info boxContent Auf den Seiten von GodmodeTrader www godmode-trader de finden Sie kostenlose tagesaktuelle Chartanalysen Prognosen und Aktienanalysen B u00f6rsennews und Echtzeit-Nachrichten Echtzeit-Kurse Trading-Services Angebote zum Thema u201eB u00f6rse u00fcr Einsteiger u201c und vieles mehr GodmodeTrader ist das reichweitenst u00e4rkste Internetportal u00fcr B u00f6rsenhandel Trading technische Analyse und Anlagestrategien im deutschsprachigen Raum T u00e4glich werden hier umfangreiche Chartanalysen von Profi-Tradern Trading-Tipps sowie Hintergrundwissen zu den Themen B u00f6rse Finanzm u00e4rkte Trading Investieren und Anlegen ver u00f6ffentlicht! Zu den Highlights auf den Seiten von GodmodeTrader geh u00f6rt der t u00e4gliche DAX-Tagesausblick von Rocco Gr u00e4fe der konkrete Marken u00fcr das DAX-Trading nennt und der zur Pflichtlekt u00fcre u00fcr zahlreiche Daytrader und Anleger geh u00f6rt Neben dem umfangreichen Gratis-Angebot bietet GodmodeTrader auch kostenpflichtige Analyse- und Trading-Services die von professionellen Tradern und Tradingcoaches betreut werden Hier k u00f6nnen Sie die einzelnen Handelsentscheidungen der Trader live verfolgen selbst nachhandeln und sich mit unseren Profis austauschen! Zudem bietet GodmodeTrader ein umfassendes Ausbildungs- und Webinarangebot u00fcr jeden Anlegertyp vom B u00f6rsenneuling bis zum erfahrenen Daytrader Trading bezeichnet im Gegensatz zum Investieren den eher kurzfristig orientierten Handel von Wertpapieren und anderen Finanzprodukten Anders als ein klassischer Anleger versucht der Trader von Kursschwankungen in einem kurzfristigen Zeithorizont zu profitieren Viele Trader st u00fctzen sich bei ihren Anlageentscheidungen und Aktienempfehlungen auf die Technische Analyse Im Gegensatz zur Fundamentalanalyse die ihre Prognosen auf gesamtwirtschaftliche und unternehmerische Daten st u00fctzt zieht die Chartanalyse Kurs- und Umsatzverl u00e4ufe der Aktien zu Rate Im Rahmen der Chartanalyse wird der historische Kursverlauf eines Index einer Aktie oder eines anderen Finanzinstruments grafisch dargestellt und ausgewertet Die vielf u00e4ltigen Methoden der Chartanalyse liefern dabei signifikante Kauf- und Verkaufssignale Prognosen u00fcber den weiteren Kursverlauf und Kursziele Chartanalyse verbessert damit entscheidend das Timing und die Profitabilit u00e4t von Anlageentscheidungen special message segment special message config single push enabled true topstories segment ursula config single api filter attribute categories id values 1309 type include marketoverview segment instrument list config title Markt u00fcberblick titleClass chart-line defaults item mode current chart enabled true width cols-5 config span 1day interval 60 generators HighLowMarkers tabs realtime selected true title Echtzeit api filter attribute listComponentOf id values 604 type include original title Original api filter attribute listComponentOf id values 605 type include live box segment live box config isStateless true headline enabled true text GodmodeTrader Newsticker article enabled true title Nachrichten limit 10 instrument enabled false setting enabled false instrumentPreview enabled false content expandable true timestamp false infinite enabled true hotkey enabled false sound enabled false comment limit 10 infinite enabled false popout enabled true news de europa segment article list config headline text Deutschland und Europa classes icon-region ger-eur defaults item hot enabled true count 1 image enabled true type teaser api limit 10 attributes body author slug commentCount teaser images teaser id source externalUrl tabs analyses title Chartanalysen und Nachrichten selected true api filter attribute categories id values 20 type include archiveButton enabled true auto true classes button right icon-arrow-right dax title DAX-Aktien api filter attribute instruments id values 118548 118686 118687 118693 118817 118955 119092 119102 119104 119234 120815 120823 121448 121676 121679 121684 121841 121955 121981 122006 122030 122037 122085 122096 122105 122117 122118 122121 123011 123104 type include attribute categories id values 20 type include archiveButton enabled true auto true classes button right icon-arrow-right ach title u00d6sterreich und Schweiz api filter attribute categories id values 20 type include attribute countries id values 5 61 type include archiveButton enabled true auto true classes button right icon-arrow-right news usa segment article list config headline text US-M u00e4rkte classes icon-region usa single hot enabled true count 1 image enabled true type teaser api attributes body author slug commentCount teaser images teaser id source externalUrl filter attribute categories id values 65 type include archiveButton enabled true auto true classes button right icon-arrow-right news forex commodities segment article list config headline text Devisen und Rohstoffe classes icon-region currency defaults item hot enabled true count 1 image enabled true type teaser api limit 7 attributes body author slug commentCount teaser images teaser id source externalUrl tabs analyses selected true title Chartanalysen und Nachrichten api filter attribute categories id values 1774 type include archiveButton enabled true auto true classes button right icon-arrow-right noblemetals title Edelmetalle api filter attribute categories id values 1774 type include attribute instruments id values 133979 133984 133983 133985 1062279 type include archiveButton enabled true auto true classes button right icon-arrow-right currencies title Devisen api filter attribute categories id values 1774 type include attribute instruments assetClass id values 3 type include archiveButton enabled true auto true classes button right icon-arrow-right fundamental comments segment article list config headline text Kommentare zu Wirtschaft B u00f6rse und Politik classes icon-chart-bar wrapper classes box-wrap blue clearfix single hot enabled true count 5 image enabled true type author api limit 7 attributes body author slug commentCount teaser source externalUrl filter attribute categories id values 827 type include archiveButton enabled true link archiv-suche?tab search-archive-tab-articles und filter categories id 827 text Mehr aus Wirtschaft B u00f6rse und Politik classes button right icon-arrow-right expert comments segment article list config headline text Kommentare zu Charttechnik Trading und Investments classes icon-news wrapper classes box-wrap green clearfix single hot enabled true count 5 image enabled true type author api limit 7 attributes body author slug commentCount teaser source externalUrl filter attribute categories id values 1258 type include archiveButton enabled false news asia segment article list config headline text Chartanalysen Asien und Emerging Markets classes icon-region chi-jap single hot enabled true count 1 image enabled true type author api limit 6 attributes body author slug commentCount teaser source externalUrl filter attribute categories id values 12 type include archiveButton enabled true auto true classes button right icon-arrow-right chart comments segment article list config headline text Charttechnische Kommentare classes icon-chart-line blocker wrapper classes box-wrap green clearfix single hot enabled true count 5 image enabled true type author api limit 7 attributes body author slug commentCount teaser source externalUrl filter attribute categories id values 64 type include archiveButton enabled true text Mehr aus Charttechnik Trading und Investments classes button right icon-arrow-right link archiv-suche?tab search-archive-tab-articles und filter categories id 64 1258 topsflops segment instrument list config title Tops Flops titleClass chart-line tabs dax selected true title DAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 133962 type include action topsflops order topsflops 4 4 mdax title MDAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 133964 type include action topsflops order topsflops 4 4 sdax title SDAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 304227 type include action topsflops order topsflops 4 4 tecdax title TecDAX mode topsflops top 4 flop 4 api filter attribute componentOf id values 133963 type include action topsflops order topsflops 4 4 dow-jones title Dow Jones mode topsflops top 4 flop 4 api filter attribute componentOf id values 133965 type include action topsflops order topsflops 4 4 nasdaq title Nasdaq mode topsflops top 4 flop 4 api filter attribute componentOf id values 133955 type include action topsflops order topsflops 4 4 calendar segment economycalendar teaser config headline text Wirtschaftsdaten-Kalender classes icon-calendar single video announcement segment video announcement config title Video Announcement titleClass video color yellow videos segment article list config headline text Die neuesten Videos von GodmodeTrader classes icon-videos single horizontal enabled true columns 4 show author true teaser false hot enabled true count 3 image enabled true type videoCover width 300 height 168 api limit 3 attributes id author autoTeaser slug specific video show commentCount filter attribute categories id values 1947 1811 1261 1948 1822 2212 type include archiveButton enabled true auto true textDefault true classes button right icon-arrow-right medium rectangle segment ad config type medium-rectangle commodity currency segment article list config headline text Nachrichten Devisen und Rohstoffe classes icon-news defaults item hot enabled true count 2 image enabled true type teaser api limit 6 attributes body author slug commentCount teaser images teaser id source externalUrl tabs all selected true title Alle api filter attribute categories id values 2118 type include archiveButton enabled true text Zum Nachrichten-Archiv link archiv-suche?tab search-archive-tab-articles und filter categories id 2118 classes button right icon-arrow-right currency title Devisen api filter attribute instruments assetClass id values 3 type include attribute categories id values 2118 type include archiveButton enabled true text Zum Nachrichten-Archiv link archiv-suche?tab search-archive-tab-articles und filter categories id 2118 instruments assetClass id 3 classes button right icon-arrow-right commodity title Rohstoffe api filter attribute instruments assetClass id values 4 type include attribute categories id values 2118 type include archiveButton enabled true text Zum Nachrichten-Archiv link archiv-suche?tab search-archive-tab-articles und filter categories id 2118 instruments assetClass id 4 classes button right icon-arrow-right news world segment article list config headline text Nachrichten weltweit classes icon-news defaults item hot enabled true count 2 image enabled true type teaser api limit 6 attributes body author slug commentCount teaser images teaser id source externalUrl tabs all selected true title Alle api filter attribute categories id values 2116 type include archiveButton enabled true text Zum Nachrichten-Archiv link archiv-suche?tab search-archive-tab-articles und filter categories id 2116 classes button right icon-arrow-right asia title Asien und Emerging Markets api filter attribute countries id values 537 type include attribute categories id values 2116 type include archiveButton enabled true text Zum Nachrichten-Archiv classes button right icon-arrow-right link archiv-suche?tab search-archive-tab-articles und filter categories id 2116 countries id 537 news stock company segment article list config headline text Analysteneinsch u00e4tzungen zu Aktien und Unternehmen classes icon-news defaults api limit 8 attributes body author slug commentCount teaser images teaser id source externalUrl tabs all selected true title Alle api filter attribute categories id values 2119 type include archiveButton enabled true text Alle Analysteneinsch u00e4tzungen classes button right icon-arrow-right link archiv-suche?tab search-archive-tab-articles und filter categories id 2119 europe title Europa api filter attribute categories id values 2119 type include attribute countries regions id values 542 type include archiveButton enabled true text Alle Analysteneinsch u00e4tzungen Europa classes button right icon-arrow-right link archiv-suche?tab search-archive-tab-articles und filter countries regions id 542 categories id 2119 na title Nordamerika api filter attribute categories id values 2119 type include attribute countries regions id values 539 type include archiveButton enabled true text Alle Analysteneinsch u00e4tzungen Nordamerika classes button right icon-arrow-right link archiv-suche?tab search-archive-tab-articles und filter countries regions id 539 categories id 2119 news certificates funds etfs segment article list config headline text Zertifikate- Fonds- und ETF-News classes icon-news single archiveButton enabled true auto true text Alle Analysteneinsch u00e4tzungen Nordamerika classes button right icon-arrow-right hot enabled true count 1 image enabled true type teaser api limit 4 attributes body author slug commentCount teaser images teaser id source externalUrl filter attribute categories id values 2117 type include news partner segment article list config headline text Nachrichten unserer Partner classes icon-news single archiveButton enabled false hot enabled true count 1 image enabled true type teaser api limit 4 attributes body author slug commentCount teaser images teaser id source externalUrl filter attribute categories id values 2138 type include latest newcomer entities segment article list config headline text Neu im Einsteigerbereich classes icon-news wrapper classes box-wrap green clearfix single boxColor green show textOnImage false horizontal enabled true columns 4 hot enabled true count 3 image enabled true type cover width 298 height 100 api limit 3 attributes commentCount author autoTeaser teaser images teaser id images teaser source slug source externalUrl filter attribute categories id values 18


sex
Kostenlose Chartanalysen aktuelle B rsennews Echtzeit Kurse B rse f r Einsteiger bietet Europas unabh ngiges Finanzportal GodmodeTrader de | godmode-trader.de
Sex xXx fick Erotik sexy hardcore
1. PR-Navi.de godmode-trader.de
2. godmode-trader.de PR-Navi.de


| tlinien Künstler Shop Aktuelles Presse Goebel Tradition und Lifestyle Goebel beschäftigt sich mit ästhetischen Dingen die das Leben schöner machen dem kleinen Luxus für die Seele Sei als Dekoration und Heimschmuck als Collectible oder als wertvolles Geschenk Goebelprodukte bereiten Freude spontan und d oebel demodulescommentcomment css?o3o8di import url www goebel desitesallmodulesdatedate apidate css?o3o8di import url www goebel desitesallmodulesdatedate popupthemesdatepicker css?o3o8di import url www goebel demodulesfieldthemefield css?o3o8di import url www goebel deprofilesdrupalexp shootmodulesco Goebel Porzellan Tradition und Lifestyle import url www goebel demodulessystemsystem base css?o3o8di import url www goebel demodulessystemsystem menus css?o3o8di import url www goebel demodulessystemsystem messages css?o3o8di import url www goebel demodulessystemsystem theme css?o3o8di import url www g mport url www goebel deprofilesdrupalexp shootthemesdrupalexpassetscssdrupalexp css?o3o8di import url www goebel deprofilesdrupalexp shootmodulesdrupalexpmodulesdexp css?o3o8di import url www goebel deprofilesdrupalexp shootthemesdrupalexpvendorbootstrapcssbootstrap min css?o3o8di import url www goebel och nachhaltig traditionell oder trendorientiert die umfangreiche Kollektion befriedigt fast jeden Geschmack Hilfe Impressum AGB Widerrufsbelehrung Karriere Kontakt Newsletter Händlerverzeichnis Facebook Shop Zum Shop Bestellinfos Versandkosten Werksverkauf s Goebel Porzellan GmbH All right reserved deprofilesdrupalexp min css?o3o8di import url www goebel deprofilesdrupalexp shootthemesdrupalexpassetscssdrupalexp-rtl css?o3o8di import url www goebel deprofilesdrupalexp css?o3o8di import url www goebel desitesdefaultfilescss injectorcss injector css?o3o8di Direkt zum Inhalt Home Unternehmen Produk palexp shootmodulesdrupalexpmodulesdexp menucssdexp-mobile-menu css?o3o8di import url www goebel demoduleslocalelocale css?o3o8di import url www goebel deprofilesdrupalexp shootmodulesdrupalexpmodulesdexp css?o3o8di import url www goebel deprofilesdrupalexp shootmodulesdrupalexpmodulesdexp css?o3o8di i ntribmenu attach blockmenu attach block css?o3o8di import url www goebel demodulesnodenode css?o3o8di import url www goebel css?o3o8di import url www goebel demodulesuseruser css?o3o8di import url www goebel demodulesforumforum css?o3o8di import url www goebel deprofilesdrupalexp shootmodulescontribvie wscssviews css?o3o8di import url www goebel deprofilesdrupalexp shootmodulescontribckeditorcssckeditor css?o3o8di import url www goebel deprofilesdrupalexp shootmodulescontribctoolscssctools css?o3o8di import url www goebel deprofilesdrupalexp shootmodulesdrupalexpmodulesdexp animationcssanimate css?o3 o8di import url www goebel deprofilesdrupalexp fancybox css?o3o8di import url www goebel deprofilesdrupalexp shootmodulescontriblightbox2csslightbox css?o3o8di import url www goebel deprofilesdrupalexp shootmodulesdrupalexpmodulesdexp menucssdexp-mega-menu css?o3o8di import url www goebel deprofilesdru

| | Sex xXx fick Erotik sexy hardcore | goebel.de | 1. goebel.de PR-Navi.de
2. goebel.de PR-Navi.de

| GOEBEL IMS high performance converting machinery for paper film alufoil aseptic packaging etc Made to customer requirements in Germany and Italy |
goebel-darmstadt.de
| Sex xXx fick Erotik sexy hardcore |
G FAIRS PRESS Newsletter CONTACTS NovaSlit Innovative Cooperation Our New Slitter for Hard Rolled and Soft Annealed Aluminium Foils EXPLORE CONTACT NovaSlit EXPLORE New Management Team Board! DISCOVER New Management Team Board! DISCOVER get the ball rolling for you are official sponsor of the Darmstadt German professional soccer league DISCOVER get the ball rolling for you DISCOVER MONOSLIT GIANT The MONOSLIT GIANT machine known among e litter rewinders guaranteeing high-quality processing for the paper industry drupa The paper and print industries are undergoing vast changes EUR new technologies are continuously developed due increased requirements and complexity of the markets DISCOVER IMS DELTAMATIC GROUP IMS Deltamatic Group born from the union and synergy DISCOVER CAREER Are you interested joining our company? look forward DISCOVER COMPANY PROFILE GOEBEL IMS the w Manufacturer of Slitter Rewinder and other converting machines cookie banner position fixed bottom left box-sizing padding rgba color fff z-index cookie banner titolo font-weight bold font-size cookie banner testo float left padding padding-right padding-left cookie banner tasto margin-left auto float left ececec padding color cursor cookie banner tasto hover bababa cookie banner chiudi position absolute right top color rgba cursor font the union and synergy DISCOVER CAREER Are you interested joining our company? look forward DISCOVER VDMA GOEBEL IMS participates the Pro Original campaign VDMA DISCOVER GLOBAL PARTNERS Around the globe are your reliable partner DISCOVER NEWS COMPANY NEWS SPONSORING FAIRS PRESS Newsletter CONTACTS GLOBAL PARTNERS PRODUCTS RETROFITTING SLITTING COMPANY PROFILE MISSION IMS DELTAMATIC GROUP CAREER VDMA GLOBAL PARTNERS COMPANY NEWS SPONSORIN xpertsas one of the best primary slitter rewinders EXPLORE CONTACT MONOSLIT GIANT EXPLORE The Single-Shaft Centre-Driven Slitter Rewinderfor Paper and Aseptic Packaging EXPLORE CONTACT EXPLORE The State-of-The-Art Slitter Rewinderfor Medium Gauge Foil EXPLORE CONTACT EXPLORE RAPID Most popular machine for Paper and Board and Cigarette paper EXPLORE CONTACT RAPID EXPLORE PRODUCTS Find your right product Newsletter Subscribe now and updat -size cookie banner chiudi hover color rgba ready accetta window accetta type POST url engcookie accetta php success msg cookie banner display none location reload error alert there error with engcookie accetta php vaiapolicy location href cookie policy html COOKIE POLICY This site uses cookies including third-part Clicking continuing the navigation interacting with the page you consent the cookies COOKIE POLICY English Deutsch LOGIN PR orld leading provider of slitter rewinders DISCOVER MONOSLIT Superlative Primary Slitter for Film XTRASLIT COMPACT SLITTER REWINDER FOR CONVERT Embossing Machine for Alufoil and MONOSLIT GIANT Superlative Primary Slitter for Film HOME PRODUCTS COMPANY NEWS und FAIRS SITEMAP CONTACTS COOKIE POLICY IMPRESSUM CREDITS GOEBEL Schneid und Wickelsysteme GmbH isOpen open-group click group animate top isOpen yes close-group click group animate t ed GLOBAL PARTNERS Discover our network LATEST NEWS Outstanding success for GOEBEL IMS this yearEUR drupa visitors from countries and exhibitors from countries EUR this the positive outcome reported from drupa Between May and June print and media industries met Düsseldorf Germany discover innovative technologies and recent developments for all steps of the production process DISCOVER GOEBEL IMS showcases its comprehensive portfolio of s op -500px isOpen window isOpen yes group animate top -500px isOpen menu-website-link hover submenu-website-links-container this css display block menu-website-link mouseleave submenu-website-links-container this css display none menu-btn-mobile click menu-mobile css display block black css display block black click menu-mobile css display none black css display none ready tp-banner revolution delay 573 hideThumbs navigationArrows none ODUCTS CHOOSE YOUR INDUSTRY Paper und Board Tobacco Film Alufoil Aseptic Packaging Material RETROFITTING GOEBEL IMS also offers upgrades and retrofits of existing DISCOVER Slitting systems from GOEBEL IMS represent maximum precision DISCOVER COMPANY PROFILE GOEBEL IMS the world leading provider of slitter rewinders DISCOVER MISSION reliable partner GOEBEL IMS delivers systems DISCOVER IMS DELTAMATIC GROUP IMS Deltamatic Group born from
1. goebel-darmstadt.de PR-Navi.de
2. goebel-darmstadt.de PR-Navi.de

Sex xXx fick Erotik sexy hardcore
goecking.de | |
|
is hin Lösungen Sondermaschinenbau Dabei nutzen wir die gesamte Vielfalt modernster CAD-Software Team erarbeiten wir für unsere Kunden kreative und technisch optimale Lösungen Mehr Dokumentation einem erfolgreichen Projekt gehört auch eine sorgfältige Dokumentation Denn nur ein sauber dokumentiertes Projekt bleibt auch langfristig nachvollziehbar Wir übernehmen diese Aufg ptimale Lösungen Mehr Dokumentation einem erfolgreichen Projekt gehört auch eine sorgfältige Dokumentation Denn nur ein sauber dokumentiertes Projekt bleibt auch langfristig nachvollziehbar Wir übernehmen diese Aufgabe für unsere Kunden und garantieren eine lückenlose Dokumentation Mehr Personaldienstleistungen Stetige Entwicklungen Unternehmen und fortlaufende Änderungen Münsterland Engineering GmbH Anlagenplanung Konstruktion Dokumentation document window baseUrl org images core emoji ext png svgUrl org images core emoji svg svgExt svg source concatemoji www muensterland-engineering wp-includes wp-emoji-release min js?ver canvas getContext und getContext String fromCharCode !i!i fillText return!1 switch textBaseline top font Arial case f Fachkompetenz gewährleisten wir einen effizienten und komfortablen Umgang rund die CADISON-Software Mehr Konstruktion Unsere Konstruktionsdienstleistungen erstrecken sich vom Maschinenbau über Detailkonstruktionen bis hin Lösungen Sondermaschinenbau Dabei nutzen wir die gesamte Vielfalt modernster CAD-Software Team erarbeiten wir für unsere Kunden kreative und technisch o nstleistungen Bei solchen Anforderungen unterstützen wir unsere Kunden durch die bedarfsgesteuerte Arbeitnehmerüberlassung Mehr Münsterland Engineering Profitieren auch Sie von mehr als Jahren Erfahrung Anlagenplanung Mit Hilfe unserer modernen gestalten wir die Planung Entwicklung und Konstruktion von verfahrenstechnischen Anlagen Basierend auf jahrelanger Erfahrung und illText toDataURL length Über uns Wir begleiten Sie auf Ihrem Weg! Wir sind ein mittelständisches Unternehmen Herzen des Münsterlandes und der Nachfolger der Göcking Konstruktion GmbH Oelde Mit unserem Erfahrungsschatz aus Jahren und einem dynamischen erfolgsorientierten und innovativem Team bieten wir effiziente Lösungen für die verschiedensten Branchen Mehr Anlagenplanu ng Mit Hilfe unserer modernen gestalten wir die Planung Entwicklung und Konstruktion von verfahrenstechnischen Anlagen Basierend auf jahrelanger Erfahrung und Fachkompetenz gewährleisten wir einen effizienten und komfortablen Umgang rund die CADISON-Software Mehr Konstruktion Unsere Konstruktionsdienstleistungen erstrecken sich vom Maschinenbau über Detailkonstruktionen b Arbeitsmarkt bringen immer speziellere und sehr individuelle Anforderungen die Personalplanung mit sich Dies fordert maßgeschneiderte Lösungen Bereich der Personaldienstleistungen Bei solchen Anforderungen unterstützen wir unsere Kunden durch die bedarfsgesteuerte Arbeitnehmerüberlassung Mehr finden Sie uns Münsterland Engineering GmbH Herrenstraße Oelde Telefon Telefax abe für unsere Kunden und garantieren eine lückenlose Dokumentation von der Erstellung bis hin zur Vervielfältigung Mehr Personaldienstleistungen Stetige Entwicklungen Unternehmen und fortlaufende Änderungen Arbeitsmarkt bringen immer speziellere und sehr individuelle Anforderungen die Personalplanung mit sich Dies fordert maßgeschneiderte Lösungen Bereich der Personaldie info muensterland-engineering Leistungen Anlagenplanung Konstruktion Dokumentation Personaldienstleistungen Informationen Über uns Karriere Kontakt Impressum AGB Unbedenklichkeit Münsterland Engineering Design AMP Solutions push arguments new Date async src parentNode insertBefore window document www ga ga create UA-45619883-1 muensterland-engineering ga send pageview | | 1. goecking.de PR-Navi.de
2. PR-Navi.de goecking.de


sex | | mmen frisch und in höchster Qualität auf Ihren Tisch Ob aus dem Fachhandel oder direkt aus unserem Frischeshop am Fischmarkt in Hamburg Goedeken ist immer ein Genuss Top ein Begriff bei dem jeder Genießer sofort Appetit verspürt Und der im selben Moment hohe Erwartungen weckt Diesen Ansprüchen gerecht zu werden EUR und sie zu übertreffen EUR ist seit jeher das Ziel unseres täglichen Wirkens im Traditionshaus Wilhelm Goedeken Wählen Sie aus unseren vielfältigen Köstlichkeiten ob Goedeken Klassik Goedeken Presse Qualitätsphilosophie Qualitätsmanagement NachhaltigkeitZertifikate Kontakt und Anfahrt Ansprechpartner Stellenangebote Links AGBs Datenschutz Impressum Heringssal ate Matjessalate Shrimps- und Krabbensalate Fleisch- und Geflügelsalate Käse- und Eiersalate Flusskrebssalate Eingelegte Meeresfrüchte Saucen Dressings und Mayonnaisen K Gourmet oder Goedeken Mediterran und erleben Sie die raffinierte Balance von Tradition und Moderne vereint in einzigartig komponierten Rezepturen All unsere Produkte ko kte Salatherstellung Salzheringsartikel Holländische Matjes Räucherlachs Antipasti Sardellen backstretch imagesstimmung01 jpg Genuss ist unsere Spezialität Feinkost ist Wilhelm Goedeken GmbH EUR Marinaden und Feinkostsalate seit 1926 gaq push setAccount UA-30439789-1 gaq push type async true src location ? ssl http www google-analytics comga js s getElementsByTagName 0 s parentNode insertBefore s 040-380 23 76-0 Produkte Unternehmen Qualität ServiceKontakt Kombüse Geschichte und Philosophie Manufaktur artoffel- und Nudelsalate Gemüse- und Rohkostsalate Saisonsalate Feinmarinaden Bismarckhering Delikatess-Rollmöpse Brathering Seelachsschnitzel Matjesspezialitäten Produ
goedeken-gourmet.de
Sex xXx fick Erotik sexy hardcore
| | 1. PR-Navi.de goedeken-gourmet.de
2. goedeken-gourmet.de PR-Navi.de

Sex xXx fick Erotik sexy hardcore
oat left padding rechts float right padding kontakt container solid DDDDDD margin-bottom overlayer map position absolute bottom left rgba color font-weight bold text-align center vertical-align middle font-size xx-small overlayer1 position absolute bottom left rgba color font-weight bold text-align center vertical-align middle none overlayer position absolute bottom left rgba color font-weight bold text-align center vertical-align middle none head left float left head right float right head container none list font-size display inline-block head media only screen and head media only screen and head vertical-align bottom!important media d hohe Qualität durch effektive Logistikkonzepte reibungslos ablaufende Prozesse in der Transportkette und dadurch einen Mehrwert an Service für unsere langjährigen zufriedenen Kunden Von Skandinavien über Deutschland bis nach Osteuropa EUR mit uns kommt der Norden in Fahrt Setzen Sie auf uns als verlässlichen und kompetenten Partner! Ihr Matthias Gödecke zum WEB-Portal zum Smile-Portal zur Zeiterfassung News Auszubildende tauschen sich mit unseren Kunden aus 16 Juli 2015 fortschrittliche Logistik und Transport 1 Juli 2015 AEO zertifiziert 22 Juni 2015 GÖDECKE LOGISTIK EUR Spedition aus Lübeck für LKW-Transporte von und nach Skandinavie n Deutschland EUR Dänemark EUR Schweden EUR Norwegen EUR Finnland Gödecke Eurotrans GmbH Stellmacherstraße 6-12 DE-23556 Lübeck Telefon 49 4 51 899 09-0 2016 Gödecke Logistik Home Kontakt Sitemap Impressum Blog custom 1430401031069 padding-top !important custom 1437996267926 margin-top 32px !important custom 1438001623728 margin-top 32px !important custom 1437996440293 margin-top 25px !important border-left-width !important padding-left !important custom 1437996494466 margin-top 32px !important custom 1430373892204 margin-top !important VERVUM Overlayer vervum click 100px 100px overlay2 position fixed left z-index width 000 filter alpha ght off forceFullWidth off hideThumbsOnMobile off hideBulletsOnMobile off hideArrowsOnMobile off hideThumbsUnderResolution hideSliderAtLimit hideCaptionAtLimit hideAllCaptionAtLilmit startWithSlide videoJsPath http goedecke-logistik dewp-contentpluginsrevsliderrs-pluginvideojs fullScreenOffsetContainer ready Über uns Geschäftsfelder Skandinavien Kontakt Kalkuliert und informiert ans Ziel Die großen Gelben Gödecke Logistik ist der internationale und moderne Transport- und Lagerexperte für den Norden Wir stehen für Qualität und Sicherheit und bieten effiziente und kundenbezogene Transportlösungen aus einer Hand Wir bauen auf gleichbleiben pt content tags-tab-content latestPost-review-wrapper background-color color fff article float right sidebar c-4-12 float left padding-left padding-right responsive wpb row span3 position relative !important padding-left !important padding-right !important tp-button !important number list padding-left footer-navigation none wpb row wpb content element wpb thumbnails-fluid last toggle margin wpb button margin-bottom !important -left-text font-size !important media -note font-size media screen and portal padding-top padding-left kontakt mobile display none media screen and kontakt desktop display none kontakt mobile display block links fl Gödecke Logistik Transporte und Logistik Skandinavien und Nordeuropa body background-color body url input author focus input email focus input url focus commentform textarea focus wpt content tags-tab-content hover menu current-menu-item current-menu-ancestor sf-with-ul current-menu-ancestor footer single post commentform hover footer hover menu hover single post post-info readMore reply carousel hover single post related-posts hover sidebar c-4-12 footer sidebar c-4-12 hover color nav-previous nav-next header-button sub-menu commentform input submit tagcloud tabber tabs selected featured-cat mts-subscribe input type submit pagination w links margin-top !important margin-left !important gelberRahmen solid ffd739 gaq push setAccount UA-36248686-1 gaq push gat anonymizeIp gaq push type async true src location ? ssl http www google-analytics comga js getElementsByTagName parentNode insertBefore Allgemein Unternehmen Menu 24h7d Service-Telefon 49 176 1717 9053 e-Mail disposition goedecke-logistik de Zuverlässige Logistik durch unsere Erfahrung und Organisation Unsere moderne Flotte bringt Sie schnell und sicher voran Unser Team für Sie tpj jQuery tpj noConflict revapi1 tpj ready if tpj rev slider 1 1 revolution undefined revslider showDoubleJqueryError rev slider 1 1 else revapi1 tpj rev slider 1 1 show revolution dottedOverlay none delay 18000 startwidth 960 startheight 350 hideThumbs 200 thumbWidth thumbHeight 50 thumbAmount 4 navigationType bullet navigationArrows solo navigationStyle round touchenabled off onHoverStop on navigationHAlign center navigationVAlign bottom navigationHOffset navigationVOffset 20 soloArrowLeftHalign left soloArrowLeftValign center soloArrowLeftHOffset 20 soloArrowLeftVOffset soloArrowRightHalign right soloArrowRightValign center soloArrowRightHOffset 20 soloArrowRightVOffset shadow fullWidth on fullScreen off stopLoop off stopAfterLoops -1 stopAtSlide -1 shuffle off autoHei opacity 60 -moz-opacity 60 opacity 60 display none container background-color f5f5f5 solid padding display none z-index 9000 overflow auto 800px 200px container2 background-color f5f5f5 solid padding display none z-index 9000 overflow auto 800px 528px media screen and 690px container 200px 350px btn1 100px btn2 100px btn1 text-align center margin 70px 10 10 padding background-color 0088e2 margin-right 50px border-radius 25px color fff 2px solid 003865 230px btn2 200px text-align center margin 70px 10 10 border-radius 25px padding background-color 0088e2 2px solid 003865 color fff if jQuery rev slider wrapper length write vervum quest n ame1 link1 name2 link2 jQuery overlay show slow jQuery container css 200px jQuery container fadeIn slow jQuery container html name2 name1 jQuery jQuery container css position absolute left 50 top 50 margin-left - container outerWidth margin-top - container outerHeight jQuery container click jQuery container hide slow jQuery overlay fadeOut jQuery overlay click jQuery container hide slow jQuery overlay fadeOut vervum pl popup if body clientWidth 850 jQuery overlay2 show slow jQuery container2 fadeIn slow jQuery get window location origin pl popup html my jQuery container html my html jQuery container css 528px jQuery container2 html
sex |
| goedecke-logistik.de


1. PR-Navi.de goedecke-logistik.de
2. goedecke-logistik.de PR-Navi.de


Wedges Driver Hybrids Putter Golftrolleys Elektrotrolleys Trolleys Golfcarts Golfbags Cartbags Standbags Travelcover Golfzubehör Golfbälle Handschuhe Tees Pitchgabel Rangefinder Bücher So ung Datum Preis aufsteigend Preis absteigend window push AnzeigenscriptAnzeigenmarkt Golfkleinanzeigen Neu auf Facebook! Added uns! Nutzungsbedigung Impressum Partnerlinks Affiliateprogram rotrolleys Trolleys Golfcarts Cartbags Standbags Travelcover Golfbälle Tees Pitchgabel Pitchmarker Handschuhe Rangefinder Bücher Sonstiges Golfschuhe Golfkleidung Golfuhr Caps LoginAccount uf von Golfschlägern kennen Neben kostenlosen Verkäufen können Sie auch kostenlos Gesuche aufgeben Viel Spaß beim Inserieren! Golfschläger Komplettsets Herreneisen Dameneisen Fairwayhölzer völlig kostenlos Golfartikel neu und gebrauchte Golfschläger kaufen bzw verkaufen! Sie bezahlen keine Gebühren oder Provisionen wie Sie dies aus anderen Verkaufsplattformen bei einem Verka h Most wanted Newest of the day Ich suche Golfschläger und more Golf Videos Golfschläger Komplettsets Herreneisen Dameneisen Fairwayhölzer Wedges Driver Putter Hybrids Juniorschläger Elekt Golfartikel finden Sie schneller einen Käufer Empfehlen Sie uns weiter und besuchen Sie unsere exklusiven Linktips! Suchbegriffe Optionen Alle Gesuche Angebote Alle privat business Sortier nstiges Accessoires Golfkleidung Golfschuhe Golfuhren Caps Sonstiges Spielpartner Golfurlaub Mitgliedschaften Denken Sie faire Preise für Ihre Golfschläger Trollys Golfbälle und sonstigen Anzeigen inserieren Meine Anzeigen suchen Paßwort vergessen? Golfkleinanzeigen Kleinanzeigen von und für Golfer Golfschläger Herzlich Willkommen auf den Golfkleinanzeigen hier können Sie Golfschläger Golfbälle Golftaschen gebrauchte Golfschläger kaufen oder Neu bei Golf Kleinanzeigen Golfschläger Golfbälle Golftaschen Hölzer Putter Chipper bei Golf Kleinanzeigen Suchen nac |
Kleidung Schuhe Mode Accessoires Handschuhe Sonstiges Damen Nach Anlass Pullover Westen Schmuck Uhren
Sex xXx fick Erotik sexy hardcore | | golfkleinanzeigen.de
Golfschläger bei Golf Kleinanzeigen kaufen gebrauchte Golfschlaeger Golfbälle Golftaschen Hölzer Putter Chipper Trolley Eisen Wedges Putter günstig billig Golfsachen
1. PR-Navi.de golfkleinanzeigen.de
2. golfkleinanzeigen.de PR-Navi.de

golflaedchen.de | Sex xXx fick Erotik sexy hardcore | Wer Golfartikel braucht bestellt sie im Golf Shop von Golfl dchen g nstig und mit Geld zur ck Garantie von Trusted Shops


| Bücher eBooks Literatur Magazine Kleidung Schuhe Mode Accessoires Armstulpen Brautaccessoires Brillenmode Linsen Handschuhe Hosenketten Hosenträger Kinderhaarspangen Kleiderbügel Krawatten Mottenschutzmittel Pulswärmer Regenschirme Schuhzubehör Taillengürtel Taschen Handtaschen MP3 Player Sporttasche Trolleys Koffer Taschenspiegel Sonstiges Allg Bekleidung Bedruck Stickerei Marken Labels Maß Schneiderei Damen Nach Anlass Arbeitsmode Hochzeit Outdoor Partymode Edle Material Gore Tex Leinen Style Outfit Abendmode Shorts Anzüge Jeans Bermudashorts Caprihosen Cargohosen Cordhosen Hüfthosen Knickerbocker Krempeljeans Latexkleidung Latzhosen Lederhosen Leinenhosen Schlaghosen Streifenhosen Thermojeans Trägerhosen Overalls Regenanzüge Röcke Umstandsmode Uniformen Stiefel Wedges Bandanas Kinderhosenträger Kinderhüte Kindermützen Kinderschals Kinderschirme Kinderstirnbänder Kinderstulpen Kindertücher Lätzchen Babymode Bademode Festliche Socken Kinderanzüge Kinderbademantel Kinderblusen Kinderhemden Kinderjeans Kindermäntel Kindernachtwäsche Kinderoveralls Kurze Limitierte Modelle Mädchenkleid Mädchenrock Schneebekleidung Shirts Polos Sportbekleidung Zipfelpulli Babyschuhe Clogs Einlegesohle Gummistiefel Hausschuhe Ballerinas Fußballschuhe Leinenschuhe Sportschuhe Klettschuhe Knöchel Lack Sandalen Sneaker Spangenschuhe Turnschuhe Wasser Männer Baseballkappen Fußballtrikots Jogginganzüge Jogginghosen Laufsportkleidung Motorradjacken Outdoorkleidung Radsportkleidung Reithosen Skibekleidung Tops Sportshirts Sportswear Stutzen Sweatshirts Tanzsportbekleidung Rucksäcke Torwarttrikots Turnsportkleidung Badeschuhe Ballettschuhe Basketballschuhe Bergschuhe Gesundheitsschuhe Golfschuhe Gymnastikschuhe Hallenschuhe Handballschuhe Jagdschuhe Jazzschuhe Kletterschuhe Langlaufschuhe Motorradstiefel Reitstiefel Skaterschuhe Skischuhe Sneakers Snowboardschuhe Sommerschuhe Freizeitschuhe Steppschuhe Tanzschuhe Tennisschuhe Trekkingschuhe Wanderschuhe Medien Nachrichten Informationen Thema Sparen
80px emotion-inner-element-0-2 width 242px height 390px emotion-element-0-3 width 252px height 400px left 504px top 480px emotion-inner-element-0-3 width 242px height 390px emotion-element-0-4 width 252px height 400px left 756px top 480px emotion-inner-element-0-4 width 242px height 390px emotion-element-0-5 width 1008px height 80px left 0px top 880px emotion-inner-element-0-5 width 998px height 70px emotion-element-0-6 width 252px height 400px left 0px top 960px emotion-inner-element-0-6 width 242px height 390px emotion-element-0-7 width 252px height 400px left 252px top 960px emotion-inner-element-0-7 width 242px height 390px emotion-element-0-8 width 252px height 400px left 504px top 960px emotion-inner-element-0-8 width 242px height 390px emotion-element-0-9 width 252px height 400px left 756px top 960px emotion-inner-element-0-9 width 242px height 390px emotion-element-0-10 width 1008px height 560px left 0px top 1360px emotion-inner-element-0-10 width 998px height 550px emotion-element-0-11 width 252px height 400px left 0px top 1920px emotion-inner-element-0-11 width 242px height 390px emotion-element-0-12 width 252px height 400px left 252px top 1920px emotion-inner-element-0-12 width 242px height 390px emotion-element-0-13 width 252px height 400px left 504px top ukte und helfen gerne bei der Auswahl Bestellen Sie online im Golf Shop Der Versand erfolgt in der Regel mit nur 1-3 Tagen Lieferzeit Vor Ort in Bensheim Golfshop zum Anfassen und Custom Fitting Uns gibt es nicht nur als Golfshop online sondern auch als Ladengeschäft südlich von Darmstadt in Bensheim Kommen Sie vorbei und finden Sie viele Artikel unseres Online-Sortiments vorrätig Wir beraten Sie rund um Ihre bevorzugten Produkte während Sie probieren austesten und nachfragen Im Golfshop bieten wir Custom Fitting d h unsere geschulten Experten ermitteln die passende Konfiguration Ihrer neuen Golfschläger und passen diese an Ihre Maße und Schwungeigenschaften an Um die besten Schläger für Sie zu finden wählen Sie aus einer großen Auswahl aktueller Modelle von Marken wie TaylorMade Cobra Wilson und Nike Diese können Sie bei uns natürlich auch ausführlich testen Kennen Sie bereits Ihre Schaftlänge den Liewinkel und die Griffstärke bestellen Sie individuelle Golfschläger einfach in unserem Golf Online Shop Alles was zur kompletten Golf-Ausrüstung gehört und mehr Im Golflädchen Ihrem Golf Versand haben Sie die Möglichkeit die verschiedenen Golfartikel nach Begriffen auszuwählen und die Produkte aller Marken miteinander zu vergleichen Mizuno Adidas und ECCO sind nur einige Golflaedchen de Golf Shop für Golfschläger Golfschuhe Golfbälle Golfbags EUR families Archivo Narrow latin src location ? http ajax googleapis comajaxlibswebfont1webfont js type textjavascript async true s getElementsByTagName 0 s parentNode insertBefore s jQuery ready cok cookie match session-1 g sid cok und cok 0 ? cok 0 null par location search match sPartner und g pid par und par 0 ? par 0 substring 9 null cur location host ref referrer indexOf cur -1 ? referrer null url www golflaedchen dewidgetsindexrefreshStatistic pth location pathname replace url replace http url indexOf ? -1 ? ? und url requestPage encodeURI pth url und requestController encodeURI index if sid url und sid if pid url und partner pid if ref url und referer encodeURI ref url und x-shopware-nocache new Date getTime ajax url dataType jsonp jQuery ready jQuery searchfield unbind jQuery searchfield val autocompleteField jQuery searchfield 0 pos keycode length 2 keycode length codechar toUpperCase ? keycode substring pos 1 keycode substring pos 1 toLowerCase textrot codechar return textrot vegas src mediaimageHintergrd-blank png fade 2000 valign top align center Um Golflädchen in vollem Umfang nutzen zu können empfehlen wir Ihnen Javascript in Ihrem Browser zu aktiveren Rufen Sie uns an 49 62 51 - 9 gbahn Jetzt bei Golflädchen im Golfshop online erleben Perfekt für den Einstieg Günstige Golfbälle für den Einstieg finden Sie in unserem Angebot aus den Bereichen Distance Bälle und Lakeballs zum Beispiel von Callaway Einfach bestellen im Golflädchen Golf Shop Jetzt besonders viel sparen mit gebrauchten Golfschlägern die in unserem Golf Shop vor Ort zum Testen oder das Fitting bereitstanden Demo Schläger Angebote mit deutlichem Nachlass gegenüber der UVP finden Sie hier Golflädchen Große Auswahl im Golfshop für Profis und Einsteiger Alles für den Golfsport aus erster Hand Willkommen im Golflädchen! Hier erhalten Sie vom Golfschläger bis zum Tee alles was Sie benötigen um mit Freude und Leidenschaft dem Golfsport nachzugehen Renommierte Hersteller von Golfartikeln bieten Ihnen hier das Beste ihrer Produktpalette ausgesucht von den Mitarbeitern von Golflädchen Sei es Golfbekleidung Golfschuhe Golfschläger Golf Trolleys Golftaschen oder Golfzubehör unsere Mitarbeiter sind erfahrene Golfspieler und betreuen ein umfangreiches Sortiment in unserem Golf Shop Bereits seit 2002 vertrauen Kunden auf unsere Expertise und kompetente Beratung und ndash ob persönlich in unserem Ladengeschäft am Telefon oder per E-Mail über unseren Golfshop online Wir kennen jedes unserer 5000 Prod color 94c11c !important Titleist Golfbags allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Tommy Armour allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Wilson Golf Wilson Golfsets allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Wilson Staff Golfbags Wilson Staff Golfschläger Einsteiger Logo Golfbälle go Golf - das Online-Magazin Golfschläger Driver Eisen Golfsets Fairwayhölzer Hybrids Wedges Putter Golfschläger für Damen Golfschläger für Linkshänder Golfschläger für Kinder Golfbekleidung für Damen Golfbekleidung für Herren Golfschuhe Damen Golfschuhe Kinder Golfschuhe Golfbags Cartbags Standbags Golf Travelcover Golfbags fuer Damen Golftrolleys Golfbälle Golfhandschuhe Accessoires SALE - Golfschläger SALE - Golfbags SALE - Golfschuhe ready config title headline false navigation false scrollSpeed 1 rotateSpeed 1 7000 rotate true layout horizontal showNumbers true navigation true showArrows true scrollWidth 1 998 scrollHeight 1 470 slider slider banner 1340ccf24722f02bbc81b3822ce23d4c ajaxSlider locale config slider find sliding outer sliding container css height 470 slider find aja 1920px emotion-inner-element-0-13 width 242px height 390px emotion-element-0-14 width 252px height 400px left 756px top 1920px emotion-inner-element-0-14 width 242px height 390px Zuletzt angesehen window ready shopId 1 basePath localStorage isLocalStorageSupported ? window localStorage new StoragePolyFill local if localStorage getItem lastSeenArticleIndex- shopId - basePath numberOfArticles 5 viewlast lastSeenArticlesDisplayer numArticles numberOfArticles shopId basePath else viewlast hide jQuery window Informationen Impressum AGB Kontakt Ladengeschäft Golfsites Bildnachweis Jobs Kunden-Info Mein Konto Merkzettel Altbatterie-Recycling Shop Service Versand und Kosten Zahlweisen Sicherheit und Datenschutz Rücksendungen Widerrufsrecht Newsletter Als Newsletter-Abonnent profitieren Sie als Erster von unseren Angeboten!Jetzt schnell abonnieren! Das sagen unsere Kunden Alle Preise inkl der gesetzl Mehrwertsteuer ggf zuzüglich Versandkosten und Nachnahmegebühren wenn nicht anders beschrieben - Alle Rechte vorbehalten Besuchen Sie uns Besuchen Sie uns auf Facebook Golflaedchen de - Ihr Golf Shop und Golfversand für Golfschläger Golfschuhe Golfbags und Golfausrüstung - Alle Rechte vorbehalten Start Econda-Monitor2 0 2 tag params ecomm prodid ecomm pagetype home ecomm totalvalu der namhaften Hersteller von Golfzubehör deren Produkte wir in unserem Online Golfshop anbieten Wir freuen uns über Ihren Besuch! Mehr als nur ein Golfversand Hilfreiche Informationen für Ihre nächste Golfreise mit Flugzeug finden Sie in unserem Go Golf Magazin Alle Infos rund um Kosten und Beschränkungen übersichtlich an einem Ort zusammengetragen In unserem GoGolf Magazin haben wir eine der begehrtesten Destinationen für Golfreisen näher beleuchtet Lassen Sie sich von unserem Golf Shop Magazin zu einer Reise an die Algarve animieren Schuhe für Ihren liebsten Sport Stöbern Sie durch unsere Angebote in der Kategorie Golfschuhe Im Golf Online Shop von Golflädchen finden Sie eine große Auswahl verschiedener Modelle Fast immer mit kostenfreier Lieferung innerhalb Deutschlands Gut gekleidet auf dem Golfplatz Golfer finden eine große Auswahl an Golf Bekleidung wie Hosen Polos und Regen Bekleidung bei Golflädchen - Ihrem Golf Shop für Golfmode So erreichen Sie stets gut gekleidet das Grün emotion-element-0-0 width 1008px height 480px left 0px top 0px emotion-inner-element-0-0 width 998px height 470px emotion-element-0-1 width 252px height 400px left 0px top 480px emotion-inner-element-0-1 width 242px height 390px emotion-element-0-2 width 252px height 400px left 252px top 4 3 69 80 Golflädchen Versandkostenfrei ab 50 EUR D 100 EUR AT Mein Konto Merkzettel ServiceHilfe Impressum Trusted Shops AGB Kontakt Mein Konto Ladengeschäft Jobs Versand und Kosten Zahlweisen Newsletter Sicherheit und Datenschutz Rücksendungen Widerrufsrecht Warenkorb 0 Artikel 0 00 und euro Start Hersteller allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Alle Hersteller allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Adidas Golfbekleidung Adidas Golfschuhe allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Alberto Golfhosen allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Bag Boy Trolleys Bag Boy Golfbags allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Bennington Golfbags allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Big Max Trolleys allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Cobra Golf Cobra Golfschläger Cobra Driver Cobra xSlider css height 470 jQuery Persönlich getestet und für den Golfshop ausgewählt das sind die Golf Trolleys von Bag Boy und Big Max in der Preisspanne von 50 bis 450 Euro Plus Zubehör wie Transporttaschen Regenschutz oder Kartenhalter Ob robust oder besonders leicht mit fixierten Schlägerköpfen oder als Damenmodell Die Auswahl an Golf Bags in unserem Golf Shop ist riesig Hier finden Sie auch Travelcover für Transport und Reise Vertrauen Sie auf unsere fachkundige Beratung! Gerade bei den Einsteiger Golfsets müssen Preis und Leistung stimmen Im Einsteiger Golf Shop bieten wir zudem alles vom Eisen bis zum Ball für Damen Herren Linkshänder und in Überlängen Ein Golfball mit Ihrem Firmenlogo ist das perfekte Geschenk Wählen Sie günstige Golfbälle die wir in hoher Stückzahl direkt beim Hersteller bedrucken lassen Oder bestellen Sie eine kleinere Menge Premiumbälle exklusiv für Ihre besten Kunden Der Nachfolger der erfolgreichen Pro Staff HL Komplettsets jetzt bei uns im Angebot und im Golf Shop online bestellbar Die Pro Staff HDX Golfsets bieten den optimalen Einstieg in den Golf Sport und sind für Herren Damen und Linkshänder erhältlich Die Neuheit 2016 von Taylor Made Die neuen Taylor Made M1 Driver Fairwayhölzer und Rescues mit maximalen Einstell-Möglichkeiten der Flu Golfbags allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Ecco Golf allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important FootJoy Golfschuhe allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Mizuno Golfbags Mizuno Golfhandschuhe Mizuno Golfschläger allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Nike Golf Nike Golfbags Nike Golfbekleidung Nike Golfhandschuhe Nike Golfschläger Nike Putter Nike Golfschuhe allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Ogio Golfbags allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Puma Golf Puma Golfbekleidung Puma Golfschuhe allehersteller background-color 3c3d3c !important color !important allehersteller hover color 94c11c !important Taylor Made Golfschläger Taylor Made Driver Taylor Made Fairwayhölzer Taylor Made Eisen Taylor Made Putter Taylor Made Golfbags Taylor Made Golfbälle allehersteller background-color 3c3d3c !important color !important allehersteller hover | 1. PR-Navi.de golflaedchen.de
2. PR-Navi.de golflaedchen.de

Sex xXx fick Erotik sexy hardcore

g nstige golfschl ger golfbag und golfb lle im golfshop vom golftempel de golfgeschenke sowie golfausr stung f r jeden golder und golferin golfturniere golfreisen golfpreise turnierpreise
| | r Golfshop ist der Golftempel Herzlich Willkommen Gast! Möchten Sie sich anmelden? Oder wollen Sie ein Kundenkonto eröffnen? Ihr Golfshop für ausgefallene Golfgeschenke mit vielen individuellen Golfartikeln VERSANDKOSTENFREIE LIEFERUNG INNERHALB DEUTSCHLANDS Golftempel bieten w hause Schmuckvolles für Golfer Golfservietten und Karten Golf und Wohnen Kinder-Golf Golf-Magnetschmuck GUTSCHEINE Bestseller Papiertaschentücher Golftaschentücher EUR incl UST exkl write Versandkosten Puttingset Putting Set Holz Koffer EUR incl UST exkl write Versandkosten Gol Golf-Fußmatte KING GOLF die Golf-Fußmatte KING GOLF ist eine elegante und dezent-wirkende Matte die ihren Eingangsbereich sicherlich verschönert Die Rückenbeschichtung und der schwarze Gummirand machen die stabile Golf-Fußmatte KING GOLF rutschfest und langlebig EUR incl UST e sten Unsere AGB Impressum Kontakt HändlerFirmen Partnerprogramm GOLFBALLDRUCK Widerrufsbelehrung Faxbestellung Partner Weitere Artikel-Infos GolfbälleGolfballdruck eigenes Golf-Design RSS-FEED RSS Feed anzeigen Weitere Informationen Folgen Sie uns auf Twitter Golfgeschenke - Ih xkl write Versandkosten Golfballkollektion Sport mit verschiedenen Golfbällen die Golfballkollektion Sport ist eine Rarität unter den Motiven Sechs verschiedene ausgefallen Golfballmotive aus verschiedenen Sportarten der schönen Box 22 EUR incl UST exkl write Versandkosten Golfgeschenke - Ihr Golfshop ist der Golftempel Startseite Katalog Ihr Konto Warenkorb Kasse Warenkorb Sie haben noch keine Artikel Ihrem Warenkorb Suche Erweiterte Suche Kategorien Euro und mehr die Euro Artikel TOP und NEU! Geschenke Ostern Weihnachtsgeschenke Witzig und Lust ig FotoWerbe-Druck Golfball-Geschenksets Golfbälle witzig bedruckt Golfbälle allen Farben Marken-Golfbälle Golfbags und Trolleys Puttingmatten Puttingsets Golf auf Bayerisch Damen Pink Golf Golfgeschenke Damen Golfgeschenke Herren Golf Fussabstreifer Golfzubehör Bürogolf und Zu ir Ihnen verschiedene Golfartikel und Golfgeschenke Geschenkartikel für Frauen Männer und Kinder Wir personalisieren Ihre Golfbälle oder Golfartikel mit Ihrem Foto Logo oder witzigen Spruch Wir führen Magnetschmuck Golfmatten Golfsets Puttingmatten und Bürogolf Lassen Sie sich ganz entspannt durch unseren Golfshop leiten und entdecken Sie die Vielfalt Geschenken für Golfer wie Puttingmatten Indoor Golf Golfsets bedruckte Golfbälle farbige Golfbälle oder Magnetschmuck Golfgeschenke Weihnachten Geburtstag Turnierpreise Tee-Geschenke Ostern Neue Artikel f-Mouse-Set EUR incl UST exkl write Versandkosten Happy Birthday EUR incl UST exkl write Versandkosten Puttingmatte Putting Matte PLATIN EUR incl UST exkl write Versandkosten Bewertungen Der Beschenkte ist vor Lachen zusammengebroch-en POTTY PUTT Mehr über Liefer- und Versandko
golftempel.de
| 1. golftempel.de PR-Navi.de
2. golftempel.de PR-Navi.de

gollan.de


|
t online bestellen Tourenpläne Tourenplan Alveslohe Tourenplan Amt Boostedt-Rickling Tourenplan Amt Bad Bramstedt-Land Tourenplan Amt Bornhöved Tourenplan Amt Itzstedt Tourenplan Amt Kaltenkirchen-Land Tourenplan Amt Kisdorf Tourenplan Amt Leezen Tourenplan Amt Trave-Land Tourenplan Bad Bramstedt Tourenplan Bad Segeberg Tourenplan Boostedt Tourenplan Bornhöved Tourenplan Ellerau Tourenplan Großenaspe Tourenplan Henstedt -Ulzburg Tourenplan Itzstedt Tourenplan Kaltenkirchen Tourenplan Kisdorf Tourenplan Leezen Tourenplan Lentföhrden Tourenplan Nahe Tourenplan Rickling Tourenplan Schmalfeld Tourenplan Seth Tourenplan Trappenkamp Tourenplan Wahlstedt Tourenplan Nordwestmecklenburg Tourenplan Kreis Plön Stadt Plön die Gemeinden Ascheberg Bösdorf und Dörnick Tourenplan Kreis Plön Amt Lütjenburg Gemeinden Lammershagen Martensrade und Selent r kaufmännisch Bei Gollan haben Sie die Sicherheit eines gut aufgestellten Unternehmens mit acht Standorten dass seit für Qualität steht und das sicher nicht zuletzt wegen seiner guten Mitarbeiterinnen! Leitende Position Zu den Stellenangeboten Kaufmännische Berufe Zu den Stellenangeboten Gewerbliche Berufe Zu den Stellenangeboten Ausbildung Duale Studiengänge Jetzt informieren Online-Bewerbung Bewerben Sie sich online AVG Johannistal recycling Gollan Bau GmbH bau Gollan GmbH werkstatt Gollan Recycling GmbH recycling gollan Wohnungsbaugesellschaft Neustadt GmbH wobau gollan Treuhand- und Grundstücksverwaltungs GmbH treugrund gollan LeihFIX info gollan Online-Bestellungen Container Jetzt online bestellen Leerungsauftrag Jetzt Auftrag online erteilen Blaue Tonne Jetzt online bestellen Gelbe Tonne Jetzt online bestellen Braune Tonne Jetz Tourenplan Kreis Plön Amt Schrevenborn Amt Großer Plöner See Amt Selent-Schlesen Stadt Preetz Amt Preetz-Land Amt Bokhorst-Wankendorf Stadt Schwentinental Tourenplan Probstei Amt Probstei Standorte Alle Standorte Karriere bei Gollan Willkommen als Mitarbeiterin! Sie möchten sich verändern oder sind zurzeit arbeitslos? Sie suchen eine Herausforderung einer familiär geführten Unternehmensgruppe? handwerklich technisch ode Gollan Unternehmensgruppe window wpemojiSettings baseUrl org images core emoji ext png source concatemoji wp12624804 server-he wp-includes wp-emoji-release min js?ver canvas getContext und getContext String fromCharCode !g!g fillText return!1 switch textBaseline top font Arial case fillText toDataURL length case diversity fillText getImageData data fillText getImageData data case simple fillText getImageData data case u n Sie attraktive Baugrundstücke Erwerb direkt vom Eigentümer RUND UMS AUTO Wartung Diagnose Unfallreparatur Achsvermessung Klimaanlagenwartung und Instandsetzung aller KFZ-Typen bis zur TÜV-Abnahme Hause Aktuelles Bock auf eigene Scholle HEINTEICHKOPPEL bietet attraktive Baugrundstücke! Ihre braune Tonne Zum Online-Bestellformular Kulturwerft Gollan Internationale Kunst Kultur und Bock auf eigene Scholle? LÜBSCHER MÜHLE nicode8 fillText getImageData data return!1 src type head appendChild for Array simple unicode8 diversity supports everything Toggle navigation Recycling und Container Containerdienst Schlacken und Ascheaufbereitung Straßen- und Gehwegreinigung Entsorgung Abbruch Kabelrecycling Wertstoffankauf Deponien Zertifikate Verkauf und Lieferung Sieben und Schreddern AGB Handwerk und Bauen Tiefbau Schlüssel-fertigbau Rohbau Zimme NBERG bietet attraktive Baugrundstücke! Partner GOLLAN Bau GmbH Alle Rechte vorbehalten Unternehmen Newsletter Impressum Rechtliches Hotlines Zentrale Montag Freitag von Uhr Containerdienst Montag Freitag von Uhr Gelber Sack Montag Freitag von Uhr Recycling Montag Freitag von Uhr Immobilien und Baugrund Montag Freitag von Uhr Werkstatt und Reifen Montag Donnerstag von Uhr Freitag von Uhr Samstag von Uhr E-Mail-Adressen rei Tischlerei Immobilien und Baugrund Baumeister-Haus Kauf- Miet- und Anlageobjekte Baugrund Werkstatt und Reifen Kfz-Werkstatt Reifendepot und -handel Autoteileshop Hotlines E-Mail-Adressen Online-Bestellungen Tourenpläne Standorte Karriere bei Gollan RICHTFEST ZUM FESTPREIS Der Preis für Ihr Bauprojekt steht bei uns vorher fest Und Ihr Haus ewig BESTELLT und ABGEHOLT Hier wird alles abserviert BAUEN SIE RAUF Entdecke
Arbeit Beruf Karriere Arbeiten Ausland Arbeitskleidung Arbeitslosigkeit Arbeitspolitik Arbeitssicherheit Arbeitssucht Berufe Berufswahl Bewerbung Training Bewerbungen Familie Elternzeit Haus Familienarbeit Sonstiges Freiberufler Grundeinkommen Hartz Headhunter Messen Kongresse Mobbing Organisationen Zukunft der Immobilien Wohnen Bauen Baufinanzierung Baugrundstücke Baukosten Baupartner Bauplanung Bausachverständige Bauspardarlehen Bausparen Bautrends Bauunternehmen Checklisten Holzbauweise Modernisierung Musterhäuser Rohbau Außenwand Decke Dämmung Fassade Keller Sanierung Trockenbau Umbau Verträge Wohnungsbauprämie Info Beratung Versteigerungstermine Objekte Nach Wohnungen Zimmer
Sex xXx fick Erotik sexy hardcore | 1. PR-Navi.de gollan.de
2. gollan.de PR-Navi.de

| sex | Sex xXx fick Erotik sexy hardcore

ntakt Kontaktformular Ansprechpartner Anfahrt AGB Impressum Datenschutz Navigation überspringen Home Produkte Marken Full Service Unternehmen News Karriere Downloads Kontakt Produkte Marken Full Service Produktsuche Suchen Sie mit Hilfe diverser Kriterien nach Ihrem Traumprodukt! Zur Suche News Spog push enableLinkTracking try u location ? http tacke-marketing de dedi4166 your-server deanalytics paq push setTrackerUrl u piwik php paq push setSiteId 14 d g d s d getElementsByTagName 0 g type g defer true g async true g src u piwik js s parentNode insertBefore g s catch err a hreflang de html a rc replace extension -mo extension img addEvent mouseleave img setProperty src paq push setDocumentTitle title paq push setDownloadExtensions 7zaacarcarjasfasxavibincsvdocexeflvgifgzgziphqxjarjpejpegjsmp2mp3mp4mpempegmovmoviemsimsppdfphpspngpptqtmramrarseasittartgzorrenttxtwavwmawmvwpdxlsxmlzzip paq e Lieferung Außendienst Shopausstattung FAQ Unternehmen Über uns Geschichte Soziale Verantwortung Team News Newsarchiv Pressearchiv Aktionsware Karriere Golze als Arbeitgeber Ausbildung bei Golze Stellenangebote Bewerbungsformular Downloads Kataloge Flyer Verlege- und Pflegeempfehlungen AGB Golze Ko Fax 49 0 51 55 959 - 149 E-Mail info golze de News Spoga Gafa 2016 Wir freuen uns auf Ihren Besuch! Weiterlesen EUR Spoga Gafa 2016 Neuer Anprechpartner im Außendienst Seit dem 01 Mai 2016 hat Klaus Marquardt wieder das Verkaufsgebiet für Golze übernommen Weiterlesen EUR Neuer Anprechpartner im Auß griffe Deutsch English Zielseite Navigation Home Produkte Aluprofil-Systeme Badematten Bodenbeläge Naturfaser Bordürenteppiche Stufenmatten Teppiche Türmatten Produktsuche Marken Dachmarke Golze 1873 Astra Schöner Wohnen-Kollektion Lars Contzen Ako Full Service Wunschmaß Große Lagerkapazität schnell Startseite - Otto Golze und Söhne GmbH window MooTools write gaq push setAccount UA-48884118-1 gaq push gat anonymizeIp setTimeout gaq push NoBounce Over seconds gaq push type async true src location ? ssl http www google-analytics comga js s getElementsByTagName 0 s parentNode insertBefore s Suchbe hreflang de html a hreflang en html a hreflang en html span active lang-de html span active lang-de html span active lang-en html span active lang-en html new Request url systemhtmlcron txt onComplete txt if !txt txt 0 if parseInt txt Math round new Date 1000 - 300 new Request url cron php get endienst Sitemap Navigation überspringen Produkte Marken Full Service Unternehmen News Karriere Downloads Kontakt AGB Impressum Datenschutz window addEvent domready hover img each img src img getProperty src extension src substring src lastIndexOf src length img addEvent mouseenter img setProperty s a Gafa 2016 Wir freuen uns auf Ihren Besuch! Weiterlesen EUR Spoga Gafa 2016 Aktionsware Neu Regionsmatten Trendige Sauberlaufmatten für jede Region! Weiterlesen EUR Neu Regionsmatten Sprache Deutsch English Kontaktdaten Otto Golze und Söhne GmbH Langes Feld 29 31860 Emmerthal Tel 49 0 51 55 959 - 0 |

golze.de | 1. golze.de PR-Navi.de
2. golze.de PR-Navi.de



---
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58

Domde_00 Domde_0a Domde_0b Domde_0c Domde_0d Domde_0e Domde_0f Domde_0g Domde_0h Domde_0i Domde_0j Domde_0k Domde_0l Domde_0m Domde_0n Domde_0o Domde_0p Domde_0q Domde_0r Domde_0s Domde_0t Domde_0u Domde_0v Domde_0w Domde_0x Domde_0y Domde_0z Domde_a0 Domde_aa Domde_ab Domde_ac Domde_ad Domde_ae Domde_af Domde_ag Domde_ah Domde_ai Domde_aj Domde_ak Domde_al Domde_am Domde_an Domde_ao Domde_ap Domde_aq Domde_ar Domde_as Domde_at Domde_au Domde_av Domde_aw Domde_ax Domde_ay Domde_az Domde_b0 Domde_ba Domde_bb Domde_bc Domde_bd Domde_be Domde_bf Domde_bg Domde_bh Domde_bi Domde_bj Domde_bk Domde_bl Domde_bm Domde_bn Domde_bo Domde_bp Domde_bq Domde_br Domde_bs Domde_bt Domde_bu Domde_bv Domde_bw Domde_bx Domde_by Domde_bz Domde_c0 Domde_ca Domde_cb Domde_cc Domde_cd Domde_ce Domde_cf Domde_cg Domde_ch Domde_ci Domde_cj Domde_ck Domde_cl Domde_cm Domde_cn Domde_co Domde_cp Domde_cq Domde_cr Domde_cs Domde_ct Domde_cu Domde_cv Domde_cw Domde_cx Domde_cy Domde_cz Domde_d0 Domde_da Domde_db Domde_dc Domde_dd Domde_de Domde_df Domde_dg Domde_dh Domde_di Domde_dj Domde_dk Domde_dl Domde_dm Domde_dn Domde_do Domde_dp Domde_dq Domde_dr Domde_ds Domde_dt Domde_du Domde_dv Domde_dw Domde_dx Domde_dy Domde_dz Domde_e0 Domde_ea Domde_eb Domde_ec Domde_ed Domde_ee Domde_ef Domde_eg Domde_eh Domde_ei Domde_ej Domde_ek Domde_el Domde_em Domde_en Domde_eo Domde_ep Domde_eq Domde_er Domde_es Domde_et Domde_eu Domde_ev Domde_ew Domde_ex Domde_ey Domde_ez Domde_f0 Domde_fa Domde_fb Domde_fc Domde_fd Domde_fe Domde_ff Domde_fg Domde_fh Domde_fi Domde_fj Domde_fk Domde_fl Domde_fm Domde_fn Domde_fo Domde_fp Domde_fq Domde_fr Domde_fs Domde_ft Domde_fu Domde_fv Domde_fw Domde_fx Domde_fy Domde_fz Domde_g0 Domde_ga Domde_gb Domde_gc Domde_gd Domde_ge Domde_gf Domde_gg Domde_gh Domde_gi Domde_gj Domde_gk Domde_gl Domde_gm Domde_gn Domde_go Domde_gp Domde_gq Domde_gr Domde_gs Domde_gt Domde_gu Domde_gv Domde_gw Domde_gx Domde_gy Domde_gz Domde_h0 Domde_ha Domde_hb Domde_hc Domde_hd Domde_he Domde_hf Domde_hg Domde_hh Domde_hi Domde_hj Domde_hk Domde_hl Domde_hm Domde_hn Domde_ho Domde_hp Domde_hq Domde_hr Domde_hs Domde_ht Domde_hu Domde_hv Domde_hw Domde_hx Domde_hy Domde_hz Domde_i0 Domde_ia Domde_ib Domde_ic Domde_id Domde_ie Domde_if Domde_ig Domde_ih Domde_ii Domde_ij Domde_ik Domde_il Domde_im Domde_in Domde_io Domde_ip Domde_iq Domde_ir Domde_is Domde_it Domde_iu Domde_iv Domde_iw Domde_ix Domde_iy Domde_iz Domde_j0 Domde_ja Domde_jb Domde_jc Domde_jd Domde_je Domde_jf Domde_jg Domde_jh Domde_ji Domde_jj Domde_jk Domde_jl Domde_jm Domde_jn Domde_jo Domde_jp Domde_jq Domde_jr Domde_js Domde_jt Domde_ju Domde_jv Domde_jw Domde_jx Domde_jy Domde_jz Domde_k0 Domde_ka Domde_kb Domde_kc Domde_kd Domde_ke Domde_kf Domde_kg Domde_kh Domde_ki Domde_kj Domde_kk Domde_kl Domde_km Domde_kn Domde_ko Domde_kp Domde_kq Domde_kr Domde_ks Domde_kt Domde_ku Domde_kv Domde_kw Domde_kx Domde_ky Domde_kz Domde_l0 Domde_la Domde_lb Domde_lc Domde_ld Domde_le Domde_lf Domde_lg Domde_lh Domde_li Domde_lj Domde_lk Domde_ll Domde_lm Domde_ln Domde_lo Domde_lp Domde_lq Domde_lr Domde_ls Domde_lt Domde_lu Domde_lv Domde_lw Domde_lx Domde_ly Domde_lz Domde_m0 Domde_ma Domde_mb Domde_mc Domde_md Domde_me Domde_mf Domde_mg Domde_mh Domde_mi Domde_mj Domde_mk Domde_ml Domde_mm Domde_mn Domde_mo Domde_mp Domde_mq Domde_mr Domde_ms Domde_mt Domde_mu Domde_mv Domde_mw Domde_mx Domde_my Domde_mz Domde_n0 Domde_na Domde_nb Domde_nc Domde_nd Domde_ne Domde_nf Domde_ng Domde_nh Domde_ni Domde_nj Domde_nk Domde_nl Domde_nm Domde_nn Domde_no Domde_np Domde_nq Domde_nr Domde_ns Domde_nt Domde_nu Domde_nv Domde_nw Domde_nx Domde_ny Domde_nz Domde_o0 Domde_oa Domde_ob Domde_oc Domde_od Domde_oe Domde_of Domde_og Domde_oh Domde_oi Domde_oj Domde_ok Domde_ol Domde_om Domde_on Domde_oo Domde_op Domde_oq Domde_or Domde_os Domde_ot Domde_ou Domde_ov Domde_ow Domde_ox Domde_oy Domde_oz Domde_p0 Domde_pa Domde_pb Domde_pc Domde_pd Domde_pe Domde_pf Domde_pg Domde_ph Domde_pi Domde_pj Domde_pk Domde_pl Domde_pm Domde_pn Domde_po Domde_pp Domde_pq Domde_pr Domde_ps Domde_pt Domde_pu Domde_pv Domde_pw Domde_px Domde_py Domde_pz Domde_q0 Domde_qa Domde_qb Domde_qc Domde_qd Domde_qe Domde_qf Domde_qg Domde_qh Domde_qi Domde_qj Domde_qk Domde_ql Domde_qm Domde_qn Domde_qo Domde_qp Domde_qq Domde_qr Domde_qs Domde_qt Domde_qu Domde_qv Domde_qw Domde_qx Domde_qy Domde_qz Domde_r0 Domde_ra Domde_rb Domde_rc Domde_rd Domde_re Domde_rf Domde_rg Domde_rh Domde_ri Domde_rj Domde_rk Domde_rl Domde_rm Domde_rn Domde_ro Domde_rp Domde_rq Domde_rr Domde_rs Domde_rt Domde_ru Domde_rv Domde_rw Domde_rx Domde_ry Domde_rz Domde_s0 Domde_sa Domde_sb Domde_sc Domde_sd Domde_se Domde_sf Domde_sg Domde_sh Domde_si Domde_sj Domde_sk Domde_sl Domde_sm Domde_sn Domde_so Domde_sp Domde_sq Domde_sr Domde_ss Domde_st Domde_su Domde_sv Domde_sw Domde_sx Domde_sy Domde_sz Domde_t0 Domde_ta Domde_tb Domde_tc Domde_td Domde_te Domde_tf Domde_tg Domde_th Domde_ti Domde_tj Domde_tk Domde_tl Domde_tm Domde_tn Domde_to Domde_tp Domde_tq Domde_tr Domde_ts Domde_tt Domde_tu Domde_tv Domde_tw Domde_tx Domde_ty Domde_tz Domde_u0 Domde_ua Domde_ub Domde_uc Domde_ud Domde_ue Domde_uf Domde_ug Domde_uh Domde_ui Domde_uj Domde_uk Domde_ul Domde_um Domde_un Domde_uo Domde_up Domde_uq Domde_ur Domde_us Domde_ut Domde_uu Domde_uv Domde_uw Domde_ux Domde_uy Domde_uz Domde_v0 Domde_va Domde_vb Domde_vc Domde_vd Domde_ve Domde_vf Domde_vg Domde_vh Domde_vi Domde_vj Domde_vk Domde_vl Domde_vm Domde_vn Domde_vo Domde_vp Domde_vq Domde_vr Domde_vs Domde_vt Domde_vu Domde_vv Domde_vw Domde_vx Domde_vy Domde_vz Domde_w0 Domde_wa Domde_wb Domde_wc Domde_wd Domde_we Domde_wf Domde_wg Domde_wh Domde_wi Domde_wj Domde_wk Domde_wl Domde_wm Domde_wn Domde_wo Domde_wp Domde_wq Domde_wr Domde_ws Domde_wt Domde_wu Domde_wv Domde_ww Domde_wx Domde_wy Domde_wz Domde_x0 Domde_xa Domde_xb Domde_xc Domde_xd Domde_xe Domde_xf Domde_xg Domde_xh Domde_xi Domde_xj Domde_xk Domde_xl Domde_xm Domde_xn Domde_xo Domde_xp Domde_xq Domde_xr Domde_xs Domde_xt Domde_xu Domde_xv Domde_xw Domde_xx Domde_xy Domde_xz Domde_y0 Domde_ya Domde_yb Domde_yc Domde_yd Domde_ye Domde_yf Domde_yg Domde_yh Domde_yi Domde_yj Domde_yk Domde_yl Domde_ym Domde_yn Domde_yo Domde_yp Domde_yq Domde_yr Domde_ys Domde_yt Domde_yu Domde_yv Domde_yw Domde_yx Domde_yy Domde_yz Domde_z0 Domde_za Domde_zb Domde_zc Domde_zd Domde_ze Domde_zf Domde_zg Domde_zh Domde_zi Domde_zj Domde_zk Domde_zl Domde_zm Domde_zn Domde_zo Domde_zp Domde_zq Domde_zr Domde_zs Domde_zt Domde_zu Domde_zv Domde_zw Domde_zx Domde_zy Domde_zz Domother_00 Domother_0a Domother_0b Domother_0c Domother_0d Domother_0e Domother_0f Domother_0g Domother_0h Domother_0i Domother_0j Domother_0k Domother_0l Domother_0m Domother_0n Domother_0o Domother_0p Domother_0q Domother_0r Domother_0s Domother_0t Domother_0u Domother_0v Domother_0w Domother_0x Domother_0y Domother_0z Domother_a0 Domother_aa Domother_ab Domother_ac Domother_ad Domother_ae Domother_af Domother_ag Domother_ah Domother_ai Domother_aj Domother_ak Domother_al Domother_am Domother_an Domother_ao Domother_ap Domother_aq Domother_ar Domother_as Domother_at Domother_au Domother_av Domother_aw Domother_ax Domother_ay Domother_az Domother_b0 Domother_ba Domother_bb Domother_bc Domother_bd Domother_be Domother_bf Domother_bg Domother_bh Domother_bi Domother_bj Domother_bk Domother_bl Domother_bm Domother_bn Domother_bo Domother_bp Domother_bq Domother_br Domother_bs Domother_bt Domother_bu Domother_bv Domother_bw Domother_bx Domother_by Domother_bz Domother_c0 Domother_ca Domother_cb Domother_cc Domother_cd Domother_ce Domother_cf Domother_cg Domother_ch Domother_ci Domother_cj Domother_ck Domother_cl Domother_cm Domother_cn Domother_co Domother_cp Domother_cq Domother_cr Domother_cs Domother_ct Domother_cu Domother_cv Domother_cw Domother_cx Domother_cy Domother_cz Domother_d0 Domother_da Domother_db Domother_dc Domother_dd Domother_de Domother_df Domother_dg Domother_dh Domother_di Domother_dj Domother_dk Domother_dl Domother_dm Domother_dn Domother_do Domother_dp Domother_dq Domother_dr Domother_ds Domother_dt Domother_du Domother_dv Domother_dw Domother_dx Domother_dy Domother_dz Domother_e0 Domother_ea Domother_eb Domother_ec Domother_ed Domother_ee Domother_ef Domother_eg Domother_eh Domother_ei Domother_ej Domother_ek Domother_el Domother_em Domother_en Domother_eo Domother_ep Domother_eq Domother_er Domother_es Domother_et Domother_eu Domother_ev Domother_ew Domother_ex Domother_ey Domother_ez Domother_f0 Domother_fa Domother_fb Domother_fc Domother_fd Domother_fe Domother_ff Domother_fg Domother_fh Domother_fi Domother_fj Domother_fk Domother_fl Domother_fm Domother_fn Domother_fo Domother_fp Domother_fq Domother_fr Domother_fs Domother_ft Domother_fu Domother_fv Domother_fw Domother_fx Domother_fy Domother_fz Domother_g0 Domother_ga Domother_gb Domother_gc Domother_gd Domother_ge Domother_gf Domother_gg Domother_gh Domother_gi Domother_gj Domother_gk Domother_gl Domother_gm Domother_gn Domother_go Domother_gp Domother_gq Domother_gr Domother_gs Domother_gt Domother_gu Domother_gv Domother_gw Domother_gx Domother_gy Domother_gz Domother_h0 Domother_ha Domother_hb Domother_hc Domother_hd Domother_he Domother_hf Domother_hg Domother_hh Domother_hi Domother_hj Domother_hk Domother_hl Domother_hm Domother_hn Domother_ho Domother_hp Domother_hq Domother_hr Domother_hs Domother_ht Domother_hu Domother_hv Domother_hw Domother_hx Domother_hy Domother_hz Domother_i0 Domother_ia Domother_ib Domother_ic Domother_id Domother_ie Domother_if Domother_ig Domother_ih Domother_ii Domother_ij Domother_ik Domother_il Domother_im Domother_in Domother_io Domother_ip Domother_iq Domother_ir Domother_is Domother_it Domother_iu Domother_iv Domother_iw Domother_ix Domother_iy Domother_iz Domother_j0 Domother_ja Domother_jb Domother_jc Domother_jd Domother_je Domother_jf Domother_jg Domother_jh Domother_ji Domother_jj Domother_jk Domother_jl Domother_jm Domother_jn Domother_jo Domother_jp Domother_jq Domother_jr Domother_js Domother_jt Domother_ju Domother_jv Domother_jw Domother_jx Domother_jy Domother_jz Domother_k0 Domother_ka Domother_kb Domother_kc Domother_kd Domother_ke Domother_kf Domother_kg Domother_kh Domother_ki Domother_kj Domother_kk Domother_kl Domother_km Domother_kn Domother_ko Domother_kp Domother_kq Domother_kr Domother_ks Domother_kt Domother_ku Domother_kv Domother_kw Domother_kx Domother_ky Domother_kz Domother_l0 Domother_la Domother_lb Domother_lc Domother_ld Domother_le Domother_lf Domother_lg Domother_lh Domother_li Domother_lj Domother_lk Domother_ll Domother_lm Domother_ln Domother_lo Domother_lp Domother_lq Domother_lr Domother_ls Domother_lt Domother_lu Domother_lv Domother_lw Domother_lx Domother_ly Domother_lz Domother_m0 Domother_ma Domother_mb Domother_mc Domother_md Domother_me Domother_mf Domother_mg Domother_mh Domother_mi Domother_mj Domother_mk Domother_ml Domother_mm Domother_mn Domother_mo Domother_mp Domother_mq Domother_mr Domother_ms Domother_mt Domother_mu Domother_mv Domother_mw Domother_mx Domother_my Domother_mz Domother_n0 Domother_na Domother_nb Domother_nc Domother_nd Domother_ne Domother_nf Domother_ng Domother_nh Domother_ni Domother_nj Domother_nk Domother_nl Domother_nm Domother_nn Domother_no Domother_np Domother_nq Domother_nr Domother_ns Domother_nt Domother_nu Domother_nv Domother_nw Domother_nx Domother_ny Domother_nz Domother_o0 Domother_oa Domother_ob Domother_oc Domother_od Domother_oe Domother_of Domother_og Domother_oh Domother_oi Domother_oj Domother_ok Domother_ol Domother_om Domother_on Domother_oo Domother_op Domother_oq Domother_or Domother_os Domother_ot Domother_ou Domother_ov Domother_ow Domother_ox Domother_oy Domother_oz Domother_p0 Domother_pa Domother_pb Domother_pc Domother_pd Domother_pe Domother_pf Domother_pg Domother_ph Domother_pi Domother_pj Domother_pk Domother_pl Domother_pm Domother_pn Domother_po Domother_pp Domother_pq Domother_pr Domother_ps Domother_pt Domother_pu Domother_pv Domother_pw Domother_px Domother_py Domother_pz Domother_q0 Domother_qa Domother_qb Domother_qc Domother_qd Domother_qe Domother_qf Domother_qg Domother_qh Domother_qi Domother_qj Domother_qk Domother_ql Domother_qm Domother_qn Domother_qo Domother_qp Domother_qq Domother_qr Domother_qs Domother_qt Domother_qu Domother_qv Domother_qw Domother_qx Domother_qy Domother_qz Domother_r0 Domother_ra Domother_rb Domother_rc Domother_rd Domother_re Domother_rf Domother_rg Domother_rh Domother_ri Domother_rj Domother_rk Domother_rl Domother_rm Domother_rn Domother_ro Domother_rp Domother_rq Domother_rr Domother_rs Domother_rt Domother_ru Domother_rv Domother_rw Domother_rx Domother_ry Domother_rz Domother_s0 Domother_sa Domother_sb Domother_sc Domother_sd Domother_se Domother_sf Domother_sg Domother_sh Domother_si Domother_sj Domother_sk Domother_sl Domother_sm Domother_sn Domother_so Domother_sp Domother_sq Domother_sr Domother_ss Domother_st Domother_su Domother_sv Domother_sw Domother_sx Domother_sy Domother_sz Domother_t0 Domother_ta Domother_tb Domother_tc Domother_td Domother_te Domother_tf Domother_tg Domother_th Domother_ti Domother_tj Domother_tk Domother_tl Domother_tm Domother_tn Domother_to Domother_tp Domother_tq Domother_tr Domother_ts Domother_tt Domother_tu Domother_tv Domother_tw Domother_tx Domother_ty Domother_tz Domother_u0 Domother_ua Domother_ub Domother_uc Domother_ud Domother_ue Domother_uf Domother_ug Domother_uh Domother_ui Domother_uj Domother_uk Domother_ul Domother_um Domother_un Domother_uo Domother_up Domother_uq Domother_ur Domother_us Domother_ut Domother_uu Domother_uv Domother_uw Domother_ux Domother_uy Domother_uz Domother_v0 Domother_va Domother_vb Domother_vc Domother_vd Domother_ve Domother_vf Domother_vg Domother_vh Domother_vi Domother_vj Domother_vk Domother_vl Domother_vm Domother_vn Domother_vo Domother_vp Domother_vq Domother_vr Domother_vs Domother_vt Domother_vu Domother_vv Domother_vw Domother_vx Domother_vy Domother_vz Domother_w0 Domother_wa Domother_wb Domother_wc Domother_wd Domother_we Domother_wf Domother_wg Domother_wh Domother_wi Domother_wj Domother_wk Domother_wl Domother_wm Domother_wn Domother_wo Domother_wp Domother_wq Domother_wr Domother_ws Domother_wt Domother_wu Domother_wv Domother_ww Domother_wx Domother_wy Domother_wz Domother_x0 Domother_xa Domother_xb Domother_xc Domother_xd Domother_xe Domother_xf Domother_xg Domother_xh Domother_xi Domother_xj Domother_xk Domother_xl Domother_xm Domother_xn Domother_xo Domother_xp Domother_xq Domother_xr Domother_xs Domother_xt Domother_xu Domother_xv Domother_xw Domother_xx Domother_xy Domother_xz Domother_y0 Domother_ya Domother_yb Domother_yc Domother_yd Domother_ye Domother_yf Domother_yg Domother_yh Domother_yi Domother_yj Domother_yk Domother_yl Domother_ym Domother_yn Domother_yo Domother_yp Domother_yq Domother_yr Domother_ys Domother_yt Domother_yu Domother_yv Domother_yw Domother_yx Domother_yy Domother_yz Domother_z0 Domother_za Domother_zb Domother_zc Domother_zd Domother_ze Domother_zf Domother_zg Domother_zh Domother_zi Domother_zj Domother_zk Domother_zl Domother_zm Domother_zn Domother_zo Domother_zp Domother_zq Domother_zr Domother_zs Domother_zt Domother_zu Domother_zv Domother_zw Domother_zx Domother_zy Domother_zz



Als Premium Mitglied hast du einige Vorteile im Gegensatz zur Standart Mitgliedschaft. Unter anderen kannst du als Premium Mitglied alle 18er Bilder sehen,die FSK 18 MMS Galerie ansehen,Pornotexte der Mitglieder sehen usw.! Wie du Premium Mitglied wirst erfährst du in deiner persönlichen Verwaltung !

Kostenlos!: Private Nachrichten versendet. Bei uns sind alle Grundfunktionen für dich Kostenlos! Siehe „Unsere Features“
www.Sex-Gut.de

Baby, Familie, Kinder & Erziehung Kategorien: 160 Einträge: 0 Sponsored by » Baby & Kleinkinder » Ahnenforschung » Auto-Kindersitze... Bildung: Schulen, Unterricht, Uni Kategorien: 182 Einträge: 0 Sponsored by » Abschlussjahrgänge » Elternarbeit » Hochbegabung... Bildung: Wissenschaft, Wissen Kategorien: 414 Einträge: 0 Sponsored by » Anomalien & Alternative Wissenschaften » Atlantis » Bücher & Literatur... Bücher, eBooks, Literatur & Magazine Kategorien: 132 Einträge: 0 Sponsored by » Abkürzungen » Adressen & Telefonnummern » Anwählte, Notare, Recht & Gesetz... Büro, Betrieb & Gewerbe Kategorien: 353 Einträge: 0 Sponsored by » Akten & Dokumente » Akten- & Dokumentenmanagement » Datenträgermanagement... Computer, PC & Software Kategorien: 293 Einträge: 0 Sponsored by » Beratung, Service, Hilfe & Info » Computerbücher » EDV- Seminar... Druck, Printmedia & Druckerei Kategorien: 215 Einträge: 0 Sponsored by » Nach Anlass » Adventskalender » Anti-Valentinstag... Energieversorgung, Technik & Ressourcen Kategorien: 102 Einträge: 0 Sponsored by » Energie sparen & Energieberatung » Energieanbieter & Versorgung » Alternative Energien... Erotik, Sex & Co (FSK18) Kategorien: 1614 Einträge: 1614 Sponsored by » Agenturen » Begleitservice, Hostessen & Escort » Agenturen in der Schweiz... Esoterik, Astrologie & Horoskope Kategorien: 68 Einträge: 0 Sponsored by » Alchemie » alternatives Heilen » Amulette... Essen, Trinken: Ausgehen & Gastronomie Kategorien: 137 Einträge: 0 Sponsored by » Locations & Lounges » Ausflugs- & Wanderlokale » Autobahnraststätten... Essen, Trinken: Küche, Lebensmittel & Getränke Kategorien: 531 Einträge: 0 Sponsored by » Catering & Partyservice » Diät, Ernährung & Abnehmen » Abnehmen Tipps... Event-, Party- & Veranstaltungsservice Kategorien: 285 Einträge: 0 Sponsored by » Nach Fest, Feier & Anlass
www.PR-Navi.de

1 to 1 Chat, Nachrichten schreiben, Webcam Video Chat, Private Messages, Tapse vergeben, Gästebücher, User Speichern, User als Bekannt markieren, Power Suche, FSK 18 Galerie, User Online, Stadt Online uvm..!!! Kostenlos!

SMS an User versenden Pics direkt auf dein Handy via MMS SMS: 0.09 € in alle deutsche Mobilnetze
www.Sex-Gut.de

Startseite Suche: PR-Navi.de - 1846 Einträge in 16854 Kategorien Menü Webseiten PR Anzeigen Alle Kategorien Neue Einträge Topliste Besucher Topliste Bewertung Sponsored by Detailsuche Index A-Z Branchensuche Branchenbuch Firmenverzeichnis Werbemittel Verdienste & Cash Suchtipps So geht es... Kostenlos anmelden + 30,- Startguthaben eMail-Adresse: Passwort: Passwort vergessen? Einträge Eintrag lesen Die letzten 10 Einträge » [ mehr anzeigen ] Top-Liste Besucher » [ mehr anzeigen ] Top-Liste Bewertungen » [ mehr anzeigen ] Top-Liste Sponsored » [ mehr anzeigen ] Guten Morgen, willkommen bei www.PR-Navi.de Ihre kostenlose Webseiten PR + PageRank + Promotion + Bannerplätze + Sponsored by & Investment Ihr kostenloser Anzeigenmarkt Suchen, bieten, tauschen, verschenken, mieten, kaufen, vermieten, verkaufen. Suchmaschine der neuer Dimension, Webseiten -Suche, -Erfahrung & -Bewertung Die Top Webseiten im Internet mit Erfahrungsberichten und Bewertungen. Ihr Firmenverzeichnis & Branchenbuch ...gehen Sie online mit System . . . Jetzt kostenlos... + 30,- Startguthaben Sie erfahren hier wie Sie Ihre Webseiten, Ihre Anzeigen und vieles mehr bei uns eintragen können. Wählen Sie eine Rubrik... Anwählte, Notare, Recht & Gesetz Kategorien: 127 Einträge: 0 Sponsored by » Gerichte & Behörden » Gerichtsurteile & Rechtsstreitigkeiten » Rechtsanwälte & Notare... Arbeit, Beruf & Karriere Kategorien: 251 Einträge: 0 Sponsored by » Alkohol am Arbeitsplatz » Arbeiten Ausland » Arbeitskleidung...
www.PR-Navi.de

Kfz: Automobile, Zubehör & Co. Kategorien: 161 Einträge: 161 Sponsored by » EU-Neuwagen » Gebrauchtwagen » Jahreswagen... Kfz: Markenhäuser, Händler, Autohäuser, Info & Service Kategorien: 88 Einträge: 0 Sponsored by » Hersteller (Automobile) » Hersteller (Bus) » Hersteller (LKW)... Kfz: Motorräder, Zubehör & Co. Kategorien: 80 Einträge: 34 Sponsored by » Motorrad (Gebraucht) » Motorrad (Neu) » Old- & Youngtimer... Kfz: Nutzfahrzeuge, LKWs, Trucks, Zubehör & Co. Kategorien: 236 Einträge: 0 Sponsored by » Ersatzteile & Zubehör » Händler, Info & Service » Leasing... Kfz: Verkehr & Verschiedenes Kategorien: 128 Einträge: 1 Sponsored by » Benzin sparen » Boote & Zubehör » Hausboote... Kleidung, Schuhe, Mode & Accessoires Kategorien: 1057 Einträge: 0 Sponsored by » Accessoires » Anhänger & Anstecker » Ansteckblüten... Kosmetik, Schönheit, Lifestyle & Beauty Kategorien: 868 Einträge: 0 Sponsored by » Biokosmetik » Naturprodukte » Pflege Nacht... Kostenloses, Gratis & Gutscheine Kategorien: 6 Einträge: 0 Sponsored by » CDs & DVDs » Free & Shareware » Geschenk- & Werbeartikel... Kunst, Antiquitäten & Kultur Kategorien: 331 Einträge: 0 Sponsored by » Nach Kunststil & Epoche » Abstrakt » Acryl... Landwirtschaft, Technik, Umwelt & Natur Kategorien: 158 Einträge: 0 Sponsored by » Agrochemie » Aquakultur » Astronomie... Medien, Nachrichten & Informationen Kategorien: 228 Einträge: 0 Sponsored by » Aktuelle Nachrichten, Journalismus & Presse » Amtsblätter » Auslands Zeitungen... Medizin, Gesundheit & Pflege Kategorien: 834 Einträge: 0 Sponsored by » Alternative Medizin, Naturheilmittel & Heilpraktiker » Acai Beeren - Power » Akupunktur & Akupressur... Menschen, Vereine, Communitys, Gruppen & Treffs Kategorien: 24
www.PR-Navi.de



Home
www.pr-navi.de
www.pr-navi.de


www.pr-navi.de Sidemap Katalog Eintrag
www.pr-navi.de Sidemap Katalog Eintrag Dom
www.pr-navi.de Sidemap Anzeigen Eintrag

www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Anzeigen Eintrag

www.pr-navi.de Sidemap Anzeigen Eintrag
www.pr-navi.de Sidemap Katalog Eintrag Dom

www.pr-navi.de sidemap1 www.pr-navi.de sidemap2 www.pr-navi.de sidemap3 www.pr-navi.de sidemap4 www.pr-navi.de sidemap5 www.pr-navi.de sidemap6 www.pr-navi.de sidemap7 www.pr-navi.de sidemap8 www.pr-navi.de sidemap9 www.pr-navi.de sidemap10 www.pr-navi.de sidemap11 www.pr-navi.de sidemap12 www.pr-navi.de sidemap13 www.pr-navi.de sidemap14 www.pr-navi.de sidemap15 www.pr-navi.de sidemap16 www.pr-navi.de sidemap17 www.pr-navi.de sidemap18 www.pr-navi.de sidemap19 www.pr-navi.de sidemap20 www.pr-navi.de sidemap21 www.pr-navi.de sidemap22 www.pr-navi.de sidemap23 www.pr-navi.de sidemap24 www.pr-navi.de sidemap25 www.pr-navi.de sidemap26 www.pr-navi.de sidemap27 www.pr-navi.de sidemap28 www.pr-navi.de sidemap29 www.pr-navi.de sidemap30 www.pr-navi.de sidemap31 www.pr-navi.de sidemap32 www.pr-navi.de sidemap33 www.pr-navi.de sidemap34 www.pr-navi.de sidemap35 www.pr-navi.de sidemap36 www.pr-navi.de sidemap37 www.pr-navi.de sidemap38 www.pr-navi.de sidemap39 www.pr-navi.de sidemap40 www.pr-navi.de sidemap41 www.pr-navi.de sidemap42 www.pr-navi.de sidemap43 www.pr-navi.de sidemap44 www.pr-navi.de sidemap45 www.pr-navi.de sidemap46 www.pr-navi.de sidemap47 www.pr-navi.de sidemap48 www.pr-navi.de sidemap49 www.pr-navi.de sidemap50 www.pr-navi.de sidemap51 www.pr-navi.de sidemap52 www.pr-navi.de sidemap53 www.pr-navi.de sidemap54 www.pr-navi.de sidemap55 www.pr-navi.de sidemap56 www.pr-navi.de sidemap57 www.pr-navi.de sidemap58 www.pr-navi.de sidemap59 www.pr-navi.de sidemap60 www.pr-navi.de sidemap61 www.pr-navi.de sidemap62 www.pr-navi.de sidemap63 www.pr-navi.de sidemap64 www.pr-navi.de sidemap65 www.pr-navi.de sidemap66 www.pr-navi.de sidemap67 www.pr-navi.de sidemap68 www.pr-navi.de sidemap69 www.pr-navi.de sidemap70 www.pr-navi.de sidemap71 www.pr-navi.de sidemap72 www.pr-navi.de sidemap73 www.pr-navi.de sidemap74 www.pr-navi.de sidemap75 www.pr-navi.de sidemap76 www.pr-navi.de sidemap77 www.pr-navi.de sidemap78 www.pr-navi.de sidemap79 www.pr-navi.de sidemap80 www.pr-navi.de sidemap81 www.pr-navi.de sidemap82 www.pr-navi.de sidemap83 www.pr-navi.de sidemap84 www.pr-navi.de sidemap85 www.pr-navi.de sidemap86 www.pr-navi.de sidemap87 www.pr-navi.de sidemap88 www.pr-navi.de sidemap89 www.pr-navi.de sidemap90 www.pr-navi.de sidemap91 www.pr-navi.de sidemap92 www.pr-navi.de sidemap93 www.pr-navi.de sidemap94 www.pr-navi.de sidemap95 www.pr-navi.de sidemap96 www.pr-navi.de sidemap97 www.pr-navi.de sidemap98 www.pr-navi.de sidemap99 www.pr-navi.de sidemap100 www.pr-navi.de sidemap101 www.pr-navi.de sidemap102 www.pr-navi.de sidemap103 www.pr-navi.de sidemap104 www.pr-navi.de sidemap105 www.pr-navi.de sidemap106 www.pr-navi.de sidemap107 www.pr-navi.de sidemap108 www.pr-navi.de sidemap109 www.pr-navi.de sidemap110 www.pr-navi.de sidemap111 www.pr-navi.de sidemap112 www.pr-navi.de sidemap113 www.pr-navi.de sidemap114 www.pr-navi.de sidemap115 www.pr-navi.de sidemap116 www.pr-navi.de sidemap117 www.pr-navi.de sidemap118 www.pr-navi.de sidemap119 www.pr-navi.de sidemap120 www.pr-navi.de sidemap121 www.pr-navi.de sidemap122 www.pr-navi.de sidemap123 www.pr-navi.de sidemap124 www.pr-navi.de sidemap125 www.pr-navi.de sidemap126 www.pr-navi.de sidemap127 www.pr-navi.de sidemap128 www.pr-navi.de sidemap129 www.pr-navi.de sidemap130 www.pr-navi.de sidemap131 www.pr-navi.de sidemap132 www.pr-navi.de sidemap133 www.pr-navi.de sidemap134 www.pr-navi.de sidemap135 www.pr-navi.de sidemap136 www.pr-navi.de sidemap137 www.pr-navi.de sidemap138 www.pr-navi.de sidemap139 www.pr-navi.de sidemap140 www.pr-navi.de sidemap141 www.pr-navi.de sidemap142 www.pr-navi.de sidemap143 www.pr-navi.de sidemap144 www.pr-navi.de sidemap145 www.pr-navi.de sidemap146 www.pr-navi.de sidemap147 www.pr-navi.de sidemap148 www.pr-navi.de sidemap149 www.pr-navi.de sidemap150 www.pr-navi.de sidemap151 www.pr-navi.de sidemap152 www.pr-navi.de sidemap153 www.pr-navi.de sidemap154 www.pr-navi.de sidemap155 www.pr-navi.de sidemap156 www.pr-navi.de sidemap157 www.pr-navi.de sidemap158 www.pr-navi.de sidemap159 www.pr-navi.de sidemap160 www.pr-navi.de sidemap161 www.pr-navi.de sidemap162 www.pr-navi.de sidemap163 www.pr-navi.de sidemap164 www.pr-navi.de sidemap165 www.pr-navi.de sidemap166 www.pr-navi.de sidemap167 www.pr-navi.de sidemap168 www.pr-navi.de sidemap169 www.pr-navi.de sidemap170 www.pr-navi.de sidemap171 www.pr-navi.de sidemap172 www.pr-navi.de sidemap173 www.pr-navi.de sidemap174 www.pr-navi.de sidemap175 www.pr-navi.de sidemap176 www.pr-navi.de sidemap177 www.pr-navi.de sidemap178 www.pr-navi.de sidemap179 www.pr-navi.de sidemap180 www.pr-navi.de sidemap181 www.pr-navi.de sidemap182



Seite generiert in 0.9466 Sekunden